Clone LD24696 Report

Search the DGRC for LD24696

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:246
Well:96
Vector:pOT2
Associated Gene/TranscriptCG9436-RA
Protein status:LD24696.pep: gold
Preliminary Size:1300
Sequenced Size:1306

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9436 2001-01-01 Release 2 assignment
CG9436 2002-05-15 Blastp of sequenced clone
CG9436 2003-01-01 Sim4 clustering to Release 3
CG9436 2008-04-29 Release 5.5 accounting
CG9436 2008-08-15 Release 5.9 accounting
CG9436 2008-12-18 5.12 accounting

Clone Sequence Records

LD24696.complete Sequence

1306 bp (1306 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118938

> LD24696.complete
AAGCTTTCGACGAGCTGGAACAGATAGAGATTTGATCGCGAGAAAGGCGT
AGTAGCACTGGTTTAGACTTAGAAGCGTCCAATTTGCACAGCGTTAATTA
TCAGCGCCAGCGACAAGATGACCAATCTGGCTCCCACCATCCGGCTGAAC
AACGGGCGCGAGATGCCAACTCTGGGCCTTGGCACCTGGAAGTCGTTCGA
GTCGGACGCCTACCACTCAACGCGCCACGCCCTCGACGTGGGCTACCGGC
ACCTGGACACCGCCTTCGTCTACGAGAACGAGGCTGAGGTGGGCCAGGCG
ATCTCCGAGAAGATCGCCGAGGGAGTGGTCACACGCGAGGAGGTTTTCGT
GACCACCAAGCTAGGCGGAATCCACCACGACCCTGCATTGGTGGAGCGCG
CCTGCCGCCTGAGCCTTAGCAACCTGGGTTTGGAATACGTAGACCTCTAC
CTGATGCACATGCCGGTGGGCCAGAAGTTCCACAATGACAGCAACGTGCA
CGGAACCCTGGAGCTGACGGACGTGGACTATCTGGACACCTGGCGCGAGA
TGGAGAAGCTGGTGGATCTGGGCCTGACGCGCAGCATCGGCCTGTCCAAC
TTCAACGCCGCGCAGACGGAGCGAGTGCTAGCCAACTGCCGCATCCGGCC
GGTAGTGAACCAGGTGGAGTGCCACCCAGGCTTTCAGCAGCGCCAGCTCC
GGGAGCATGCCAAGCGCCACGGACTGGTCATCTGCGCCTACTGCCCCCTG
GCACGTCCCCAGCCCGCTCGGCAGTGGCCGCCCTTCCTCTACGACGAGCA
TGCCCAGAATCTGGCCAAGAAGTACGGCCGCACCACGGCACAGATCTGCC
TGCGTTATCTGGTCCAGCTAGGCGTGGTGCCACTGCCCAAGTCGTCGAAC
AAGGCCCGCATCGAGGAGAACTTCCGCGTCTTCGACTTCGAGCTGAGTCC
AGACGACGTCGCCGGCATGGAGCAGTATCACACCGGGCAGCGCACGGTAC
CCTTTTCGGGAATGTCGGGCCATAAGTACTACCCGTTCAACGACGAGTTC
TAGACGGGCTCAGGGGTGTCCCAGAAATATCGGTTTCGCCGTTATTGGAT
TGGCTAGGAATGCAAACAAAACGACTGTGGCATTCCAAGAGGGGTGTTTT
GTTTTAGTTGTTAACTCAAAGTTAAAAAGGTTTCGAGTAAACCCGTGCAT
TAATTCCCCTTAATATTTTACTGGAAGAGGTTCGTAAGACACCCCGCATA
TGTAGTATTTGTATTGTAAAATAAAGTATATTACGTAGAAAAAAAAAAAA
AAAAAA

LD24696.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9436.a 1605 CG9436.a 318..1605 1..1288 6440 100 Plus
CG9436-RA 1299 CG9436-RA 12..1299 1..1288 6440 100 Plus
CG10863-RA 1242 CG10863-RA 607..678 535..606 210 86.1 Plus
CG10863-RA 1242 CG10863-RA 295..350 238..293 175 87.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2644834..2646121 1288..1 6425 99.9 Minus
chr3L 24539361 chr3L 3941076..3941150 606..532 195 84 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:16:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6757599..6758888 1290..1 6450 100 Minus
3L 28110227 3L 3941683..3941754 606..535 210 86.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6758798..6760087 1290..1 6450 100 Minus
3L 28103327 3L 3941683..3941754 606..535 210 86.1 Minus
3L 28103327 3L 3942170..3942225 293..238 175 87.5 Minus
3L 28103327 3L 3939271..3939346 607..532 170 81.5 Minus
3L 28103327 3L 3939787..3939855 293..225 150 81.1 Minus
Blast to na_te.dros performed on 2019-03-16 21:51:17 has no hits.

LD24696.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:52:17 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2644834..2646121 1..1288 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:03:14 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 1..936 118..1053 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:15 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 1..936 118..1053 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:06:39 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 1..936 118..1053 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:53 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 1..936 118..1053 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:09 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 1..936 118..1053 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:28:59 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 12..1299 1..1288 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:15 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 12..1299 1..1288 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:06:39 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 16..1303 1..1288 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:53 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 1..1286 3..1288 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:09 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
CG9436-RA 16..1303 1..1288 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:17 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6757601..6758888 1..1288 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:17 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6757601..6758888 1..1288 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:17 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6757601..6758888 1..1288 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:06:39 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2645106..2646393 1..1288 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:10 Download gff for LD24696.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6758800..6760087 1..1288 100   Minus

LD24696.hyp Sequence

Translation from 117 to 1052

> LD24696.hyp
MTNLAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAF
VYENEAEVGQAISEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSL
SNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLELTDVDYLDTWREMEKLVD
LGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHAKR
HGLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQ
LGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMS
GHKYYPFNDEF*

LD24696.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9436-PA 311 CG9436-PA 1..311 1..311 1661 100 Plus
CG10638-PD 317 CG10638-PD 3..317 4..311 950 57.1 Plus
CG10638-PA 317 CG10638-PA 3..317 4..311 950 57.1 Plus
CG10863-PA 316 CG10863-PA 1..316 1..311 910 51.9 Plus
CG12766-PA 320 CG12766-PA 12..314 11..308 833 50.8 Plus

LD24696.pep Sequence

Translation from 117 to 1052

> LD24696.pep
MTNLAPTIRLNNGREMPTLGLGTWKSFESDAYHSTRHALDVGYRHLDTAF
VYENEAEVGQAISEKIAEGVVTREEVFVTTKLGGIHHDPALVERACRLSL
SNLGLEYVDLYLMHMPVGQKFHNDSNVHGTLELTDVDYLDTWREMEKLVD
LGLTRSIGLSNFNAAQTERVLANCRIRPVVNQVECHPGFQQRQLREHAKR
HGLVICAYCPLARPQPARQWPPFLYDEHAQNLAKKYGRTTAQICLRYLVQ
LGVVPLPKSSNKARIEENFRVFDFELSPDDVAGMEQYHTGQRTVPFSGMS
GHKYYPFNDEF*

LD24696.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13790-PA 311 GF13790-PA 1..311 1..311 1589 92.6 Plus
Dana\GF10249-PA 317 GF10249-PA 7..317 6..311 910 51.4 Plus
Dana\GF24014-PA 313 GF24014-PA 21..313 26..311 882 53.9 Plus
Dana\GF10250-PA 320 GF10250-PA 3..314 2..308 848 50.3 Plus
Dana\GF24531-PA 350 GF24531-PA 38..350 6..311 657 45.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:33:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10801-PA 311 GG10801-PA 1..311 1..311 1663 97.7 Plus
Dere\GG14235-PA 316 GG14235-PA 1..316 1..311 942 52.8 Plus
Dere\GG13825-PA 299 GG13825-PA 6..299 25..311 897 55.4 Plus
Dere\GG13823-PA 296 GG13823-PA 4..296 26..311 858 53.2 Plus
Dere\GG14236-PA 320 GG14236-PA 12..314 11..308 853 50.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20139-PA 311 GH20139-PA 1..311 1..311 1430 81 Plus
Dgri\GH15710-PA 317 GH15710-PA 6..317 5..311 913 52.2 Plus
Dgri\GH16848-PA 385 GH16848-PA 36..343 4..307 718 43.8 Plus
Dgri\GH16631-PA 318 GH16631-PA 1..318 1..311 699 46.2 Plus
Dgri\GH16629-PA 321 GH16629-PA 4..315 6..310 660 40.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG9436-PA 311 CG9436-PA 1..311 1..311 1661 100 Plus
CG10638-PD 317 CG10638-PD 3..317 4..311 950 57.1 Plus
CG10638-PA 317 CG10638-PA 3..317 4..311 950 57.1 Plus
CG10863-PA 316 CG10863-PA 1..316 1..311 910 51.9 Plus
CG12766-PA 320 CG12766-PA 12..314 11..308 833 50.8 Plus
CG10638-PB 310 CG10638-PB 3..310 4..307 774 46.8 Plus
ARY-PD 384 CG40064-PD 37..344 4..307 705 43.5 Plus
CG6084-PD 316 CG6084-PD 4..316 6..311 703 45.7 Plus
CG6084-PA 316 CG6084-PA 4..316 6..311 688 44.8 Plus
CG6084-PB 350 CG6084-PB 37..350 5..311 677 44.9 Plus
CG6084-PC 350 CG6084-PC 37..350 5..311 662 44 Plus
CG6083-PA 322 CG6083-PA 4..314 6..307 645 42 Plus
ARY-PC 366 CG40064-PC 53..326 38..307 643 44.2 Plus
CG2767-PA 329 CG2767-PA 7..327 8..311 541 36.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:33:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20232-PA 311 GI20232-PA 1..311 1..311 1449 82 Plus
Dmoj\GI13068-PA 317 GI13068-PA 3..317 4..311 953 54 Plus
Dmoj\GI12765-PA 317 GI12765-PA 9..317 8..311 925 53.4 Plus
Dmoj\GI13069-PA 384 GI13069-PA 37..347 4..310 734 45 Plus
Dmoj\GI11589-PA 318 GI11589-PA 1..318 1..311 695 45.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10976-PA 311 GL10976-PA 1..311 1..311 1500 85.5 Plus
Dper\GL16200-PA 317 GL16200-PA 7..317 6..311 943 54.3 Plus
Dper\GL24949-PA 440 GL24949-PA 130..440 12..311 890 51.1 Plus
Dper\GL15622-PA 379 GL15622-PA 36..343 4..307 727 44.5 Plus
Dper\GL22808-PA 318 GL22808-PA 1..318 1..311 696 44.7 Plus
Dper\GL24949-PA 440 GL24949-PA 3..126 4..127 334 49.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21786-PA 311 GA21786-PA 1..311 1..311 1500 85.5 Plus
Dpse\GA10606-PA 317 GA10606-PA 7..317 6..311 942 54.3 Plus
Dpse\GA23569-PA 317 GA23569-PA 24..317 25..311 890 53.4 Plus
Dpse\GA23568-PA 312 GA23568-PA 2..310 3..307 737 44.3 Plus
Dpse\GA23131-PA 379 GA23131-PA 36..343 4..307 727 44.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14027-PA 316 GM14027-PA 1..316 1..311 928 51.6 Plus
Dsec\GM24650-PA 544 GM24650-PA 250..544 24..311 879 54.6 Plus
Dsec\GM14028-PA 320 GM14028-PA 12..314 11..308 843 50.5 Plus
Dsec\GM24728-PA 320 GM24728-PA 4..314 6..307 662 42.6 Plus
Dsec\GM24729-PA 373 GM24729-PA 57..373 3..311 651 46.4 Plus
Dsec\GM24650-PA 544 GM24650-PA 3..251 4..248 642 48.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10303-PA 311 GD10303-PA 1..311 1..311 1674 99 Plus
Dsim\GD13308-PA 316 GD13308-PA 1..316 1..311 930 51.6 Plus
Dsim\GD12714-PA 544 GD12714-PA 250..544 24..311 880 54.9 Plus
Dsim\GD13309-PA 320 GD13309-PA 12..314 11..308 845 50.5 Plus
Dsim\GD12788-PA 320 GD12788-PA 4..314 6..307 665 42.6 Plus
Dsim\GD12714-PA 544 GD12714-PA 3..251 4..248 642 48.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20182-PA 311 GJ20182-PA 1..311 1..311 1457 83 Plus
Dvir\GJ13816-PA 317 GJ13816-PA 4..317 5..311 971 55.4 Plus
Dvir\GJ16106-PA 318 GJ16106-PA 5..318 3..311 928 53.2 Plus
Dvir\GJ13817-PA 385 GJ13817-PA 37..342 4..305 731 45.4 Plus
Dvir\GJ11267-PA 352 GJ11267-PA 37..352 3..311 667 44.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22153-PA 311 GK22153-PA 1..311 1..311 1497 84.6 Plus
Dwil\GK16694-PA 314 GK16694-PA 3..314 5..311 928 52.2 Plus
Dwil\GK12210-PA 317 GK12210-PA 1..317 1..311 910 52.7 Plus
Dwil\GK12624-PA 300 GK12624-PA 16..300 34..311 889 55.4 Plus
Dwil\GK12622-PA 310 GK12622-PA 2..310 3..307 750 44 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24510-PA 311 GE24510-PA 1..311 1..311 1655 97.7 Plus
Dyak\GE20663-PA 316 GE20663-PA 1..316 1..311 932 51.6 Plus
Dyak\GE20116-PA 544 GE20116-PA 250..544 24..311 880 54.6 Plus
Dyak\GE20664-PA 320 GE20664-PA 12..314 11..308 852 50.8 Plus
Dyak\GE14627-PA 386 GE14627-PA 37..344 4..307 712 43.8 Plus
Dyak\GE20116-PA 544 GE20116-PA 3..251 4..248 635 46.6 Plus