Clone LD24889 Report

Search the DGRC for LD24889

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:248
Well:89
Vector:pOT2
Associated Gene/TranscriptScsalpha-RA
Protein status:LD24889.pep: gold
Preliminary Size:1300
Sequenced Size:1250

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1065 2001-01-01 Release 2 assignment
CG1065 2001-10-10 Blastp of sequenced clone
CG1065 2003-01-01 Sim4 clustering to Release 3
Scsalpha 2008-04-29 Release 5.5 accounting
Scsalpha 2008-08-15 Release 5.9 accounting
Scsalpha 2008-12-18 5.12 accounting

Clone Sequence Records

LD24889.complete Sequence

1250 bp (1250 high quality bases) assembled on 2001-10-10

GenBank Submission: AY089549

> LD24889.complete
CACTATTCGGCCGATTTCGCACTGCATTAATTAAACGCGTTTTAATTGAG
TAAAGCTGTTTTTATCGCACAACCACCACACACAGATAATATGGCTGCTT
CAATGAGGGCGCTGCTGAAAGTGCGAGATGGCTTCGTGGCCGGAGTGCGC
TGCAATTCGCAGTACAACAAGACGCGCGGCAACTTGAAGCTGAACGGCGA
TTCGCGGGTGATCTGCCAGGGATTCACCGGCAAACAGGGCACGTTCCACA
GCCAACAGGCTCTGGAGTACGGCACCAAGTTGGTCGGCGGCATTTCCCCC
AAGAAGGGAGGCACCCAGCATCTGGGACTGCCCGTCTTCGCTTCGGTGGC
GGAGGCCAAGAAGGCCACCGATCCACATGCCACCGTCATCTATGTGCCAC
CACCGGGCGCTGCGGCCGCCATCATCGAGGCTCTGGAAGCGGAGATCCCC
CTGATCGTTTGCATTACGGAGGGTGTGCCGCAGCACGACATGGTGAAGGT
GAAGCACGCCCTCATCAGCCAGAGCAAGTCGCGATTGGTGGGTCCCAACT
GCCCGGGAATCATCGCCCCCGAACAGTGCAAGATCGGCATCATGCCGGGT
CACATTCACAAGCGCGGCAAGATCGGCGTGGTCTCGCGCTCGGGAACCTT
GACCTACGAGGCCGTGCACCAGACCACGGAGGTGGGTCTGGGCCAGACCC
TGTGCGTGGGCATTGGAGGCGATCCGTTCAACGGAACCGACTTCATCGAC
TGCCTGGAGGTCTTCCTCAAGGATCCCGAGACCAAGGGCATCATCCTGAT
CGGCGAGATCGGAGGCGTTGCCGAGGAGAAGGCTGCCGACTACCTGACCG
AGTACAATTCGGGCATCAAGGCCAAGCCTGTCGTCTCGTTCATTGCCGGA
GTGTCGGCGCCACCCGGCCGTCGCATGGGTCACGCTGGAGCCATCATTTC
CGGAGGAAAGGGAGGTGCCAACGACAAGATCGCCGCCCTGGAGAAGGCCG
GCGTCATTGTGACCAGGAGTCCTGCCAAAATGGGCCACGAGCTCTTCAAG
GAGATGAAGCGTCTGGAGTTAGTGTAAATAATTAAAGGCCATAACCAAAC
CGGAATCCGTACGCCGATCAAAGCGTATACGCAAACTCATGATGATGAAC
CTAACGTTAAGCTAAAAGTGTCGAAAATCGAAATTGCATTCGAGCGAACC
CAAATAAATTATTGTGAAAAATTACTAGAGAGAAAAAAAAAAAAAAAAAA

LD24889.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:03:21
Subject Length Description Subject Range Query Range Score Percent Strand
Scsalpha-RA 1673 Scsalpha-RA 155..1389 1..1235 6175 100 Plus
Scsalpha.a 1495 Scsalpha.a 45..896 1..852 4260 100 Plus
Scsalpha.a 1495 Scsalpha.a 896..1269 862..1235 1870 100 Plus
CG6255-RA 1188 CG6255-RA 541..765 526..750 375 77.7 Plus
CG6255-RA 1188 CG6255-RA 793..1020 778..1005 330 76.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:25:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3816072..3816522 126..576 2210 99.3 Plus
chr3L 24539361 chr3L 3817226..3817597 861..1232 1845 99.7 Plus
chr3L 24539361 chr3L 3816877..3817165 574..862 1445 100 Plus
chr3L 24539361 chr3L 3813667..3813793 1..127 635 100 Plus
chr3R 27901430 chr3R 15285931..15286400 995..526 610 75.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:16:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3816630..3817080 126..576 2255 100 Plus
3L 28110227 3L 3817783..3818157 861..1235 1875 100 Plus
3L 28110227 3L 3817434..3817722 574..862 1445 100 Plus
3L 28110227 3L 3814229..3814355 1..127 635 100 Plus
3R 32079331 3R 19462047..19462526 1005..526 615 75.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:27:53
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3816630..3817080 126..576 2255 100 Plus
3L 28103327 3L 3817783..3818157 861..1235 1875 100 Plus
3L 28103327 3L 3817434..3817722 574..862 1445 100 Plus
3L 28103327 3L 3814229..3814355 1..127 635 100 Plus
3R 31820162 3R 19203133..19203357 750..526 375 77.7 Minus
3R 31820162 3R 19202878..19203105 1005..778 330 76.3 Minus
Blast to na_te.dros performed on 2019-03-15 22:25:12 has no hits.

LD24889.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:26:16 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3813667..3813793 1..127 100 -> Plus
chr3L 3816074..3816522 128..576 99 -> Plus
chr3L 3816880..3817164 577..861 100 -> Plus
chr3L 3817227..3817597 862..1232 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:03:43 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 1..987 91..1077 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:37:50 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RB 1..987 91..1077 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:18:44 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 1..987 91..1077 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:06:45 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 1..987 91..1077 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:21:44 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 1..987 91..1077 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:18:44 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 45..1276 1..1232 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:37:50 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 40..1271 1..1232 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:18:44 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 19..1250 1..1232 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:06:45 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 45..1276 1..1232 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:21:44 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
Scsalpha-RA 19..1250 1..1232 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:16 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3814229..3814355 1..127 100 -> Plus
3L 3816632..3817080 128..576 100 -> Plus
3L 3817437..3817721 577..861 100 -> Plus
3L 3817784..3818154 862..1232 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:16 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3814229..3814355 1..127 100 -> Plus
3L 3816632..3817080 128..576 100 -> Plus
3L 3817437..3817721 577..861 100 -> Plus
3L 3817784..3818154 862..1232 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:16 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3814229..3814355 1..127 100 -> Plus
3L 3816632..3817080 128..576 100 -> Plus
3L 3817437..3817721 577..861 100 -> Plus
3L 3817784..3818154 862..1232 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:18:44 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3814229..3814355 1..127 100 -> Plus
arm_3L 3816632..3817080 128..576 100 -> Plus
arm_3L 3817437..3817721 577..861 100 -> Plus
arm_3L 3817784..3818154 862..1232 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:42:46 Download gff for LD24889.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3816632..3817080 128..576 100 -> Plus
3L 3817437..3817721 577..861 100 -> Plus
3L 3817784..3818154 862..1232 100   Plus
3L 3814229..3814355 1..127 100 -> Plus

LD24889.pep Sequence

Translation from 90 to 1076

> LD24889.pep
MAASMRALLKVRDGFVAGVRCNSQYNKTRGNLKLNGDSRVICQGFTGKQG
TFHSQQALEYGTKLVGGISPKKGGTQHLGLPVFASVAEAKKATDPHATVI
YVPPPGAAAAIIEALEAEIPLIVCITEGVPQHDMVKVKHALISQSKSRLV
GPNCPGIIAPEQCKIGIMPGHIHKRGKIGVVSRSGTLTYEAVHQTTEVGL
GQTLCVGIGGDPFNGTDFIDCLEVFLKDPETKGIILIGEIGGVAEEKAAD
YLTEYNSGIKAKPVVSFIAGVSAPPGRRMGHAGAIISGGKGGANDKIAAL
EKAGVIVTRSPAKMGHELFKEMKRLELV*

LD24889.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:39:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24225-PA 328 GF24225-PA 1..328 1..328 1694 99.1 Plus
Dana\GF22035-PA 356 GF22035-PA 39..344 23..328 1060 69.3 Plus
Dana\GF13329-PA 1097 GF13329-PA 468..801 13..322 212 26.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15160-PA 328 GG15160-PA 1..328 1..328 1692 99.1 Plus
Dere\GG15952-PA 342 GG15952-PA 21..329 20..328 1105 67 Plus
Dere\GG22311-PA 1095 GG22311-PA 539..799 74..322 201 26.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16428-PA 328 GH16428-PA 1..328 1..328 1664 97 Plus
Dgri\GH12731-PA 334 GH12731-PA 18..327 19..328 1069 67.7 Plus
Dgri\GH19829-PA 1100 GH19829-PA 544..804 74..322 207 27.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:33
Subject Length Description Subject Range Query Range Score Percent Strand
Scsalpha1-PB 328 CG1065-PB 1..328 1..328 1691 100 Plus
Scsalpha1-PA 328 CG1065-PA 1..328 1..328 1691 100 Plus
Scsalpha2-PA 342 CG6255-PA 21..329 20..328 1112 67.6 Plus
ATPCL-PF 1095 CG8322-PF 539..799 74..322 211 27.7 Plus
ATPCL-PG 1096 CG8322-PG 540..800 74..322 211 27.7 Plus
ATPCL-PE 1112 CG8322-PE 556..816 74..322 211 27.7 Plus
ATPCL-PD 1112 CG8322-PD 556..816 74..322 211 27.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:39:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12510-PA 328 GI12510-PA 1..328 1..328 1601 96.3 Plus
Dmoj\GI14987-PA 337 GI14987-PA 25..333 20..328 1040 67.3 Plus
Dmoj\GI20417-PA 1097 GI20417-PA 541..801 74..322 208 27.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25295-PA 328 GL25295-PA 1..328 1..328 1685 98.2 Plus
Dper\GL14403-PA 323 GL14403-PA 19..311 19..328 976 65.2 Plus
Dper\GL20648-PA 1069 GL20648-PA 531..791 74..322 206 27.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23751-PA 328 GA23751-PA 1..328 1..328 1685 98.2 Plus
Dpse\GA23007-PA 340 GA23007-PA 19..328 19..328 1082 69.7 Plus
Dpse\GA20986-PA 1087 GA20986-PA 531..791 74..322 207 27.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14589-PA 328 GM14589-PA 1..328 1..328 1705 99.7 Plus
Dsec\GM26905-PA 342 GM26905-PA 21..329 20..328 1114 67.3 Plus
Dsec\GM20101-PA 1095 GM20101-PA 539..799 74..322 204 27.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13780-PA 328 GD13780-PA 1..328 1..328 1708 100 Plus
Dsim\GD20111-PA 421 GD20111-PA 120..408 41..328 1016 66.8 Plus
Dsim\GD25577-PA 1095 GD25577-PA 539..799 74..322 203 27.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12416-PA 328 GJ12416-PA 1..328 1..328 1592 95.7 Plus
Dvir\GJ15342-PA 344 GJ15342-PA 24..333 19..328 1111 67.7 Plus
Dvir\GJ20089-PA 1098 GJ20089-PA 542..802 74..322 209 27.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20526-PA 328 GK20526-PA 1..328 1..328 1681 97.3 Plus
Dwil\GK16245-PA 351 GK16245-PA 1..333 5..328 1054 64.9 Plus
Dwil\GK10643-PA 1095 GK10643-PA 539..799 74..322 210 27.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:39:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Scsalpha-PA 328 GE21380-PA 1..328 1..328 1705 99.7 Plus
Dyak\GE25125-PA 342 GE25125-PA 21..329 20..328 1131 67.6 Plus
Dyak\GE14108-PA 1096 GE14108-PA 540..800 74..322 204 27.2 Plus

LD24889.hyp Sequence

Translation from 90 to 1076

> LD24889.hyp
MAASMRALLKVRDGFVAGVRCNSQYNKTRGNLKLNGDSRVICQGFTGKQG
TFHSQQALEYGTKLVGGISPKKGGTQHLGLPVFASVAEAKKATDPHATVI
YVPPPGAAAAIIEALEAEIPLIVCITEGVPQHDMVKVKHALISQSKSRLV
GPNCPGIIAPEQCKIGIMPGHIHKRGKIGVVSRSGTLTYEAVHQTTEVGL
GQTLCVGIGGDPFNGTDFIDCLEVFLKDPETKGIILIGEIGGVAEEKAAD
YLTEYNSGIKAKPVVSFIAGVSAPPGRRMGHAGAIISGGKGGANDKIAAL
EKAGVIVTRSPAKMGHELFKEMKRLELV*

LD24889.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:27:12
Subject Length Description Subject Range Query Range Score Percent Strand
Scsalpha-PB 328 CG1065-PB 1..328 1..328 1691 100 Plus
Scsalpha-PA 328 CG1065-PA 1..328 1..328 1691 100 Plus
CG6255-PA 342 CG6255-PA 21..329 20..328 1112 67.6 Plus
ATPCL-PF 1095 CG8322-PF 539..799 74..322 211 27.7 Plus
ATPCL-PG 1096 CG8322-PG 540..800 74..322 211 27.7 Plus