Clone LD24919 Report

Search the DGRC for LD24919

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:249
Well:19
Vector:pOT2
Associated Gene/TranscriptCG12267-RA
Protein status:LD24919.pep: gold
Preliminary Size:2200
Sequenced Size:1611

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12267 2001-01-01 Release 2 assignment
CG12267 2001-07-04 Blastp of sequenced clone
CG12267 2003-01-01 Sim4 clustering to Release 3
CG12267 2008-04-29 Release 5.5 accounting
CG12267 2008-08-15 Release 5.9 accounting
CG12267 2008-12-18 5.12 accounting

Clone Sequence Records

LD24919.complete Sequence

1611 bp (1611 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051718

> LD24919.complete
AGGAACCATGTCAGCCGACTACTCCCATCTGAGCTCCGCCATCCTGGAGC
AGTGCTTTGGCAAGGTGGTGCAGGCGGTGGCCGACTGCCTCTTTTCGGCC
ACCACGAGGACCCTGGGACAGATCACCAGTGCCACCAAGTTGTCGAGGAA
GGAAGTGGCATTTGCGCTGGCGGTGCTGGTCAAGTTCAGGCTGGTGGACT
TTGCCGCCTCCAAGGCAAACCCCTTCCTGGCGGAGTACGCCCTCCGGCGC
GAGGATGTTCTCTGCCTCCTAAGGTATCCTCGTTACGTTCACCTGGTGCA
AACCAAGTACGGAAATGTGGGTGCTTCCATTTCGGAGGAGTTGATTAATT
CTGGATCCGATACGGCAACTGGAATTCTGCTAAAATGCCTAGCCGAGAAT
GAAAACAAGGCAGAAAGTCCGGAGTCCTACCGCAACACCTTTCTCGAAAT
GATCACCGATCACTATATCATCAAGAGACCAGAACTGCTGGTGGGCGACG
ACCAGGATGAGAATGTGCCAAAGTTTGAGACCAACGAGTGCGATTTCTTT
AGGCATCCCAATATTGATCTTCAGTTGCTGGCCAAGATACAAAAAGGAGA
AGCCACTCTAGCGGAGGCCAGGGATTCTCACATGGTGTGGCACCTGAACC
ACGATCGCTTTCATCAAGACTTTCGAGACACCATCATGGTGGATGCTATT
GAGCGAAAACTGGGTGAAAATGCTGCAGAGTGCTTCAAATTCATATTAAA
GATTATGTATAACACAACTGATCCGTGGGAAAGAAAACTCTCCAATCAAA
TAACTTTCGTTGAAATTAAACAGGCTATTGAAAGAAAATCGAATAACCTG
GATCTCATGAAGTACTTGGACCAGTACATAAGCCTATTGACTGAGGACTC
ACTGGGATTCTTTCGAAGAGTTGGCGACATGGGTGGTGGTGTGTATGTGG
TGGATATGGAACATGCCTTCGAGTCGCTGGCCTTTGCTTGTGTGGAGTGT
GTCATCACGGAACGATTTGGCTCAAAGGCAGCCCGAATATTTCGAGTGAT
TCGATGCAAGAAATACATAGAACAGGAGGACCTGCAAAAGGAGGCCATGA
TCCCATCCAAAGAGGCCAAGTCGCTGGCGTATAATTTGTTCCAGGAACAG
TTTATTCATGTCAAGATTATTAAGAAGCCTGGCGGAGGCAGTAATGGCCC
CGCAAAGGCATTTTACCTCTTCCAGGTCAAGGAGAAAGATACCGTGAGAA
TGCTGCTTGATGCCAGCTACAAATCCCTTTATAACACAATAGAGCGATCT
AACTTCGAAAAAAATGAGCACAAGGGCCTAATTGAAAAATCACAAAGGCT
GGACAGCATCGTAGAGGCCATGAAGGAACGTGGAGAGACGGACGAGTATA
TCGCAGAGATTGTTGAGACTTTCACGCCGCCGGAATGCGAGATCCTTAAT
AAGGTGAAAAATCGCATAAAGACCTTGTCAAAAGCTGAACTGACCCTAGA
CGATACAATCTTTCTTCTGCAAATGTATCAGCATCATTGCACTACGCTGC
CAACGGGTATTCGTAAATTTAAATAAATTGTAATCATAAGGGAAAAAAAA
AAAAAAAAAAA

LD24919.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:32:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12267.a 1664 CG12267.a 68..1661 1..1594 7970 100 Plus
CG12267-RA 1675 CG12267-RA 79..1672 1..1594 7970 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:32:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8286261..8286763 282..784 2500 99.8 Plus
chr3R 27901430 chr3R 8286990..8287339 891..1240 1750 100 Plus
chr3R 27901430 chr3R 8285911..8286192 1..282 1410 100 Plus
chr3R 27901430 chr3R 8287622..8287807 1407..1592 915 99.5 Plus
chr3R 27901430 chr3R 8287398..8287565 1241..1408 825 99.4 Plus
chr3R 27901430 chr3R 8286827..8286937 785..895 540 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:16:49 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:32:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12460872..12461374 282..784 2515 100 Plus
3R 32079331 3R 12461601..12461950 891..1240 1750 100 Plus
3R 32079331 3R 12460522..12460803 1..282 1410 100 Plus
3R 32079331 3R 12462233..12462420 1407..1594 940 100 Plus
3R 32079331 3R 12462009..12462176 1241..1408 840 100 Plus
3R 32079331 3R 12461438..12461548 785..895 540 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12201703..12202205 282..784 2515 100 Plus
3R 31820162 3R 12202432..12202781 891..1240 1750 100 Plus
3R 31820162 3R 12201353..12201634 1..282 1410 100 Plus
3R 31820162 3R 12203064..12203251 1407..1594 940 100 Plus
3R 31820162 3R 12202840..12203007 1241..1408 840 100 Plus
3R 31820162 3R 12202269..12202379 785..895 540 99 Plus
Blast to na_te.dros performed on 2019-03-16 10:32:31 has no hits.

LD24919.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:33:46 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8285911..8286192 1..282 100 -> Plus
chr3R 8286262..8286763 283..784 99 -> Plus
chr3R 8286827..8286932 785..890 100 -> Plus
chr3R 8286990..8287339 891..1240 100 -> Plus
chr3R 8287398..8287565 1241..1408 99 -> Plus
chr3R 8287624..8287807 1409..1592 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:03:50 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 1..1569 8..1576 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:21:23 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RB 1..1569 8..1576 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:08:00 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 1..1569 8..1576 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:53:44 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 1..1569 8..1576 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:15 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 1..1569 8..1576 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:18:10 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 54..1645 1..1592 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:21:23 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RB 59..1650 1..1592 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:08:00 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 1..1592 1..1592 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:53:44 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 54..1645 1..1592 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:15 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12267-RA 1..1592 1..1592 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:33:46 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12460522..12460803 1..282 100 -> Plus
3R 12460873..12461374 283..784 100 -> Plus
3R 12461438..12461543 785..890 100 -> Plus
3R 12461601..12461950 891..1240 100 -> Plus
3R 12462009..12462176 1241..1408 100 -> Plus
3R 12462235..12462418 1409..1592 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:33:46 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12460522..12460803 1..282 100 -> Plus
3R 12460873..12461374 283..784 100 -> Plus
3R 12461438..12461543 785..890 100 -> Plus
3R 12461601..12461950 891..1240 100 -> Plus
3R 12462009..12462176 1241..1408 100 -> Plus
3R 12462235..12462418 1409..1592 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:33:46 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12460522..12460803 1..282 100 -> Plus
3R 12460873..12461374 283..784 100 -> Plus
3R 12461438..12461543 785..890 100 -> Plus
3R 12461601..12461950 891..1240 100 -> Plus
3R 12462009..12462176 1241..1408 100 -> Plus
3R 12462235..12462418 1409..1592 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:08:00 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8287160..8287265 785..890 100 -> Plus
arm_3R 8286244..8286525 1..282 100 -> Plus
arm_3R 8286595..8287096 283..784 100 -> Plus
arm_3R 8287323..8287672 891..1240 100 -> Plus
arm_3R 8287731..8287898 1241..1408 100 -> Plus
arm_3R 8287957..8288140 1409..1592 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:31:38 Download gff for LD24919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12201353..12201634 1..282 100 -> Plus
3R 12201704..12202205 283..784 100 -> Plus
3R 12202269..12202374 785..890 100 -> Plus
3R 12202432..12202781 891..1240 100 -> Plus
3R 12202840..12203007 1241..1408 100 -> Plus
3R 12203066..12203249 1409..1592 100   Plus

LD24919.hyp Sequence

Translation from 0 to 1575

> LD24919.hyp
GTMSADYSHLSSAILEQCFGKVVQAVADCLFSATTRTLGQITSATKLSRK
EVAFALAVLVKFRLVDFAASKANPFLAEYALRREDVLCLLRYPRYVHLVQ
TKYGNVGASISEELINSGSDTATGILLKCLAENENKAESPESYRNTFLEM
ITDHYIIKRPELLVGDDQDENVPKFETNECDFFRHPNIDLQLLAKIQKGE
ATLAEARDSHMVWHLNHDRFHQDFRDTIMVDAIERKLGENAAECFKFILK
IMYNTTDPWERKLSNQITFVEIKQAIERKSNNLDLMKYLDQYISLLTEDS
LGFFRRVGDMGGGVYVVDMEHAFESLAFACVECVITERFGSKAARIFRVI
RCKKYIEQEDLQKEAMIPSKEAKSLAYNLFQEQFIHVKIIKKPGGGSNGP
AKAFYLFQVKEKDTVRMLLDASYKSLYNTIERSNFEKNEHKGLIEKSQRL
DSIVEAMKERGETDEYIAEIVETFTPPECEILNKVKNRIKTLSKAELTLD
DTIFLLQMYQHHCTTLPTGIRKFK*

LD24919.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12267-PB 522 CG12267-PB 1..522 3..524 2683 100 Plus
CG12267-PA 522 CG12267-PA 1..522 3..524 2683 100 Plus

LD24919.pep Sequence

Translation from 7 to 1575

> LD24919.pep
MSADYSHLSSAILEQCFGKVVQAVADCLFSATTRTLGQITSATKLSRKEV
AFALAVLVKFRLVDFAASKANPFLAEYALRREDVLCLLRYPRYVHLVQTK
YGNVGASISEELINSGSDTATGILLKCLAENENKAESPESYRNTFLEMIT
DHYIIKRPELLVGDDQDENVPKFETNECDFFRHPNIDLQLLAKIQKGEAT
LAEARDSHMVWHLNHDRFHQDFRDTIMVDAIERKLGENAAECFKFILKIM
YNTTDPWERKLSNQITFVEIKQAIERKSNNLDLMKYLDQYISLLTEDSLG
FFRRVGDMGGGVYVVDMEHAFESLAFACVECVITERFGSKAARIFRVIRC
KKYIEQEDLQKEAMIPSKEAKSLAYNLFQEQFIHVKIIKKPGGGSNGPAK
AFYLFQVKEKDTVRMLLDASYKSLYNTIERSNFEKNEHKGLIEKSQRLDS
IVEAMKERGETDEYIAEIVETFTPPECEILNKVKNRIKTLSKAELTLDDT
IFLLQMYQHHCTTLPTGIRKFK*

LD24919.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17964-PA 522 GF17964-PA 1..522 1..522 2561 89.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:42:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18993-PA 522 GG18993-PA 1..522 1..522 2734 96.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18539-PA 522 GH18539-PA 1..522 1..522 2267 82.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:17:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG12267-PB 522 CG12267-PB 1..522 1..522 2683 100 Plus
CG12267-PA 522 CG12267-PA 1..522 1..522 2683 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:42:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23238-PA 522 GI23238-PA 1..522 1..522 2238 81.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27319-PA 522 GL27319-PA 1..522 1..522 2328 79.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11520-PA 522 GA11520-PA 1..522 1..522 2335 79.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24041-PA 522 GM24041-PA 1..522 1..522 2774 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18841-PA 522 GD18841-PA 1..522 1..522 2792 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10734-PA 522 GJ10734-PA 1..522 1..522 2226 80.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10977-PA 523 GK10977-PA 1..523 1..522 2205 75.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26202-PA 522 GE26202-PA 1..522 1..522 2749 97.7 Plus