Clone LD25118 Report

Search the DGRC for LD25118

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:251
Well:18
Vector:pOT2
Associated Gene/TranscriptmRpL37-RB
Protein status:LD25118.pep: gold
Sequenced Size:1377

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
mRpL37 2008-04-29 Release 5.5 accounting
mRpL37 2008-04-29 Picked prior to 5.5
mRpL37 2008-08-15 Release 5.9 accounting
mRpL37 2008-12-18 5.12 accounting

Clone Sequence Records

LD25118.complete Sequence

1377 bp assembled on 2007-09-19

GenBank Submission: BT030992

> LD25118.complete
TTTCATAACCAGTCCGCCGGGCTTCATTTCATTGAACGAAAACATAAGCA
AATCCTAACTTAAATGAGGCTGACGAACACTCTCTGTGCCCAGCACATCG
GCTGGCATTTCAAGAAGCACTGGCTGGTCCAGGGTAGGCGAGTCCCCAAG
GAAACTGGCGCCGCGGCGGAGCTCCTGAAGCTAGGTGTTCTGGTGAAGAA
TCCCGAGGATCTCTTGAACGCCAAAGTTGAAAAAAAACTAGTGGACATTG
TTGGCGCACGCGAAAAACCCGTTCCCGAGGACAGCAGGCACCCTGACTGG
CACCCCACAGTTTGCAACACTTACTCCGACAACAGCGTGCTAATTGGTGG
ATTGCCGCAGGCCCAGGTGCTGACCAACTCCATTGTGATCCAAACATTTC
CCAAGCACATCGAGGATGCCATTGCAAGTCAGCAGTTGCCAAATTCCGTA
GACAAGAGTGTCCGGCATGCGATTCTGGCATCCCACGTGCTTGATGCAGA
GCAAGTCAAGCTGCCCAAGGTGAGGCTACCGGAGAGGCCGGCCTTTAACC
TGCCCCGCTCCTACGGAATATCACACGAAAGGGTCAACCGACTGTTGGTA
AACAAACTCCTGCATGAAAGTGAAAAACTGGCTGGCCGTTCAGTCTCTGT
TCGAAGGAAGCTGATAGACAACGCGTCTTTTAAGACTTTTTTAAGCAAAG
ACGGGGATCTGCTAGGATTCTCAATCAATGCTGAAAAAGTGGTATTTGCC
AACCGAGCCATCGAAGGTGTTAAGGGAAAATTCGAAGGAGATCTGCCTGA
TCTTTACCCCATGAAGAGTACTATATCGATTCCGAAGTACCACATTTACC
AAGCTAAGAACTTGTATCCTTTGCGCTCGGACATCACCTGCTCCCACCCG
CACACCATCTTTACGGTGTTTAACAAACACCAAGTCAAAAACTCCCACGG
ATCCGAGGTCACAACTTCTCAGCTTCAGGCGAGGACACTGGTCAAAGCTT
TCGTTGTGGCAGCCGCTCGAGCAAAGCAACTGCATGGGGATTCCGTAGGA
GCTCTTCCCAAACCAATTGTTGTGCAGAGCGTCCAGACTGACGGTAGGAC
GTTCCACTTCGGAGTGTTGCAGCTGAATACCCTCGATCTTGGTGCCAATA
GCACTGCCAAGAACTATTGGTTCCATAGGCAAAACTACAATCTGTTTGCT
GAATGCTCTTATGAAGGAGGGCGAACGCATTTGGATAATTACAATGGCGA
GGTCTTCCGCATATTTAATGCTTTCTATAACAATTCCTAAAATAGAAATC
TTACTGAATAATAAAATATGTTTTTGTTATGTCTGTAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAA

LD25118.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:34:54
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL37-RB 1464 mRpL37-RB 129..1464 1..1336 6680 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6608083..6608550 1336..869 2250 98.7 Minus
chr3R 27901430 chr3R 6608944..6609291 587..240 1740 100 Minus
chr3R 27901430 chr3R 6608606..6608890 868..584 1395 99.3 Minus
chr3R 27901430 chr3R 6609354..6609592 239..1 1180 99.6 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10782562..10783030 1337..869 2345 100 Minus
3R 32079331 3R 10783424..10783771 587..240 1740 100 Minus
3R 32079331 3R 10783086..10783370 868..584 1410 99.6 Minus
3R 32079331 3R 10783834..10784072 239..1 1195 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:31:30
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10523393..10523861 1337..869 2345 100 Minus
3R 31820162 3R 10524255..10524602 587..240 1740 100 Minus
3R 31820162 3R 10523917..10524201 868..584 1410 99.6 Minus
3R 31820162 3R 10524665..10524903 239..1 1195 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:38:50 has no hits.

LD25118.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:39:44 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6608083..6608550 869..1336 98 <- Minus
chr3R 6608606..6608886 588..868 99 <- Minus
chr3R 6608944..6609291 240..587 100 <- Minus
chr3R 6609354..6609592 1..239 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:04 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RA 1..1131 64..1194 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:04:31 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RB 1..1227 64..1290 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:38:10 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RB 1..1227 64..1290 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:50:49 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RA 1..1131 64..1194 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:43:07 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RB 1..1227 64..1290 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:56:27 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RA 63..1256 1..1194 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:04:31 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RB 1..1336 1..1336 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:38:10 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RB 21..1356 1..1336 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:50:50 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RA 63..1256 1..1194 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:43:07 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL37-RB 21..1356 1..1336 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:44 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10783834..10784072 1..239 100   Minus
3R 10782563..10783030 869..1336 100 <- Minus
3R 10783086..10783366 588..868 100 <- Minus
3R 10783424..10783771 240..587 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:44 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10783834..10784072 1..239 100   Minus
3R 10782563..10783030 869..1336 100 <- Minus
3R 10783086..10783366 588..868 100 <- Minus
3R 10783424..10783771 240..587 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:39:44 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10783834..10784072 1..239 100   Minus
3R 10782563..10783030 869..1336 100 <- Minus
3R 10783086..10783366 588..868 100 <- Minus
3R 10783424..10783771 240..587 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:38:10 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6608285..6608752 869..1336 100 <- Minus
arm_3R 6608808..6609088 588..868 100 <- Minus
arm_3R 6609146..6609493 240..587 100 <- Minus
arm_3R 6609556..6609794 1..239 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:56:37 Download gff for LD25118.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10523394..10523861 869..1336 100 <- Minus
3R 10523917..10524197 588..868 100 <- Minus
3R 10524255..10524602 240..587 100 <- Minus
3R 10524665..10524903 1..239 100   Minus

LD25118.pep Sequence

Translation from 63 to 1289

> LD25118.pep
MRLTNTLCAQHIGWHFKKHWLVQGRRVPKETGAAAELLKLGVLVKNPEDL
LNAKVEKKLVDIVGAREKPVPEDSRHPDWHPTVCNTYSDNSVLIGGLPQA
QVLTNSIVIQTFPKHIEDAIASQQLPNSVDKSVRHAILASHVLDAEQVKL
PKVRLPERPAFNLPRSYGISHERVNRLLVNKLLHESEKLAGRSVSVRRKL
IDNASFKTFLSKDGDLLGFSINAEKVVFANRAIEGVKGKFEGDLPDLYPM
KSTISIPKYHIYQAKNLYPLRSDITCSHPHTIFTVFNKHQVKNSHGSEVT
TSQLQARTLVKAFVVAAARAKQLHGDSVGALPKPIVVQSVQTDGRTFHFG
VLQLNTLDLGANSTAKNYWFHRQNYNLFAECSYEGGRTHLDNYNGEVFRI
FNAFYNNS*

LD25118.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17089-PA 762 GF17089-PA 1..388 1..387 1597 73.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:44:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17265-PA 741 GG17265-PA 1..370 1..369 1821 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19566-PA 723 GH19566-PA 1..381 1..380 1333 63 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:21:55
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL37-PB 408 CG42632-PB 1..408 1..408 2129 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23861-PA 725 GI23861-PA 1..397 1..392 1275 61.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21931-PA 747 GL21931-PA 1..377 1..378 1384 66.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:44:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30165-PA 407 GA30165-PA 1..407 1..408 1489 66 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26149-PA 749 GM26149-PA 1..378 1..377 1923 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20703-PA 749 GD20703-PA 1..378 1..377 1937 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10574-PA 718 GJ10574-PA 1..382 1..382 1302 62.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13392-PA 740 GK13392-PA 1..369 1..368 1389 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24667-PA 752 GE24667-PA 1..382 1..381 1875 91.6 Plus

LD25118.hyp Sequence

Translation from 63 to 1289

> LD25118.hyp
MRLTNTLCAQHIGWHFKKHWLVQGRRVPKETGAAAELLKLGVLVKNPEDL
LNAKVEKKLVDIVGAREKPVPEDSRHPDWHPTVCNTYSDNSVLIGGLPQA
QVLTNSIVIQTFPKHIEDAIASQQLPNSVDKSVRHAILASHVLDAEQVKL
PKVRLPERPAFNLPRSYGISHERVNRLLVNKLLHESEKLAGRSVSVRRKL
IDNASFKTFLSKDGDLLGFSINAEKVVFANRAIEGVKGKFEGDLPDLYPM
KSTISIPKYHIYQAKNLYPLRSDITCSHPHTIFTVFNKHQVKNSHGSEVT
TSQLQARTLVKAFVVAAARAKQLHGDSVGALPKPIVVQSVQTDGRTFHFG
VLQLNTLDLGANSTAKNYWFHRQNYNLFAECSYEGGRTHLDNYNGEVFRI
FNAFYNNS*

LD25118.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:29
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL37-PB 408 CG42632-PB 1..408 1..408 2129 100 Plus