Clone LD25250 Report

Search the DGRC for LD25250

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:252
Well:50
Vector:pOT2
Associated Gene/TranscriptCG14277-RA
Protein status:LD25250.pep: gold
Sequenced Size:671

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14277 2009-06-05 Manual selection by Joe Carlson

Clone Sequence Records

LD25250.complete Sequence

671 bp assembled on 2009-07-30

GenBank Submission: BT089003.1

> LD25250.complete
TGAACATAATGTTGCGTCTGATTTGCGTGTTCCTGCTCAGCTGCGTTGGC
TTCCAGGCAGCCTTGGCTTGCAATGGCTACAAAGCCAAGCTGGTCAAGTT
GGAGAACTGTGCCGGCGAGGATGCCATTATGACGGTGGGCAGTGACTTCA
GCCTGAAGCTAAACAAGAAGTGTGAACTGGTACCCTCGGGCTGCATCATG
AACAAGCCGTTCAGTACCGCGGTGGCTAAGTTCAAGGTCCAGAAGGATGG
CATCGTAATGAAGGAGGGCAAGATCGATCTATGCGCCGCCATTGATCAGG
CCTCCTCCGAAGGTAAGGACATGCTAAAGCTTTTCGGAGCACCTTCCTCC
TGTCCGGTGGGCGAGGAGAAGGTGTGCGCCAACGATCACTCCGTGGATCT
GAGCAAGTACAAGGCCATGTTGGGCATGGCTCGTGGTCACCTCATCATCG
ATTCTGAGGTCAAGCATGACACGGGCAAGTCCTGCATTCATGCCGAAATC
GAGATCACCAAGAACTAGTGACGGAATCCGATCGTTGGTCTTATGTTTGT
ATTATGAGTCTTGCAAATCATGTAGTTGTAAATACGAGGGCAAAAAAAAA
TTGGTAATGCGGTGCACACACAGTGATTAAATATACAGAAAATACCGAAT
TGAAAAAAAAAAAAAAAAAAA

LD25250.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG14277-RA 832 CG14277-RA 175..829 1..655 3275 100 Plus
CG14277.a 1107 CG14277.a 175..829 1..655 3275 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:25:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8241755..8242157 72..474 2015 100 Plus
chr2L 23010047 chr2L 8242219..8242398 473..652 900 100 Plus
chr2L 23010047 chr2L 8241631..8241701 1..71 355 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:25:17
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8242783..8243185 72..474 2015 100 Plus
2L 23513712 2L 8243247..8243429 473..655 915 100 Plus
2L 23513712 2L 8242659..8242729 1..71 355 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8242783..8243185 72..474 2015 100 Plus
2L 23513712 2L 8243247..8243429 473..655 915 100 Plus
2L 23513712 2L 8242659..8242729 1..71 355 100 Plus
Blast to na_te.dros performed on 2019-03-16 14:25:17 has no hits.

LD25250.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:25:59 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8241631..8241701 1..71 100 -> Plus
chr2L 8241755..8242156 72..473 100 -> Plus
chr2L 8242220..8242398 474..652 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:12:13 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 1..510 9..518 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:53:01 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 1..510 9..518 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:36:11 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 1..510 9..518 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:32:30 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 1..510 9..518 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-30 10:39:01 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 1..644 9..652 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:53:01 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 1..652 1..652 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:36:11 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 28..679 1..652 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:32:30 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
CG14277-RA 28..679 1..652 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:25:59 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8242659..8242729 1..71 100 -> Plus
2L 8242783..8243184 72..473 100 -> Plus
2L 8243248..8243426 474..652 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:25:59 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8242659..8242729 1..71 100 -> Plus
2L 8242783..8243184 72..473 100 -> Plus
2L 8243248..8243426 474..652 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:25:59 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8242659..8242729 1..71 100 -> Plus
2L 8242783..8243184 72..473 100 -> Plus
2L 8243248..8243426 474..652 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:36:11 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8242659..8242729 1..71 100 -> Plus
arm_2L 8242783..8243184 72..473 100 -> Plus
arm_2L 8243248..8243426 474..652 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:43:53 Download gff for LD25250.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8242783..8243184 72..473 100 -> Plus
2L 8243248..8243426 474..652 100   Plus
2L 8242659..8242729 1..71 100 -> Plus

LD25250.hyp Sequence

Translation from 2 to 517

> LD25250.hyp
NIMLRLICVFLLSCVGFQAALACNGYKAKLVKLENCAGEDAIMTVGSDFS
LKLNKKCELVPSGCIMNKPFSTAVAKFKVQKDGIVMKEGKIDLCAAIDQA
SSEGKDMLKLFGAPSSCPVGEEKVCANDHSVDLSKYKAMLGMARGHLIID
SEVKHDTGKSCIHAEIEITKN*

LD25250.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14277-PB 169 CG14277-PB 1..169 3..171 876 100 Plus
CG14277-PA 169 CG14277-PA 1..169 3..171 876 100 Plus

LD25250.pep Sequence

Translation from 2 to 517

> LD25250.pep
NIMLRLICVFLLSCVGFQAALACNGYKAKLVKLENCAGEDAIMTVGSDFS
LKLNKKCELVPSGCIMNKPFSTAVAKFKVQKDGIVMKEGKIDLCAAIDQA
SSEGKDMLKLFGAPSSCPVGEEKVCANDHSVDLSKYKAMLGMARGHLIID
SEVKHDTGKSCIHAEIEITKN*

LD25250.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 16:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14629-PA 169 GF14629-PA 1..169 3..171 753 82.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 16:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10528-PA 169 GG10528-PA 1..169 3..171 833 94.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 16:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11585-PA 157 GH11585-PA 1..157 15..171 658 77.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG14277-PB 169 CG14277-PB 1..169 3..171 876 100 Plus
CG14277-PA 169 CG14277-PA 1..169 3..171 876 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 16:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17154-PA 169 GI17154-PA 7..168 9..170 635 74.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 16:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18732-PA 169 GL18732-PA 1..169 3..171 756 82.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 16:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12876-PA 169 GA12876-PA 1..169 3..171 756 82.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 16:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16865-PA 169 GM16865-PA 1..169 3..171 851 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 16:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23518-PA 169 GD23518-PA 1..169 3..171 851 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 16:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17658-PA 169 GJ17658-PA 1..168 3..170 698 76.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 16:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23818-PA 169 GK23818-PA 1..169 3..171 738 80.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 16:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18748-PA 169 GE18748-PA 1..169 3..171 835 94.7 Plus