BDGP Sequence Production Resources |
Search the DGRC for LD25250
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 252 |
Well: | 50 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14277-RA |
Protein status: | LD25250.pep: gold |
Sequenced Size: | 671 |
Gene | Date | Evidence |
---|---|---|
CG14277 | 2009-06-05 | Manual selection by Joe Carlson |
671 bp assembled on 2009-07-30
GenBank Submission: BT089003.1
> LD25250.complete TGAACATAATGTTGCGTCTGATTTGCGTGTTCCTGCTCAGCTGCGTTGGC TTCCAGGCAGCCTTGGCTTGCAATGGCTACAAAGCCAAGCTGGTCAAGTT GGAGAACTGTGCCGGCGAGGATGCCATTATGACGGTGGGCAGTGACTTCA GCCTGAAGCTAAACAAGAAGTGTGAACTGGTACCCTCGGGCTGCATCATG AACAAGCCGTTCAGTACCGCGGTGGCTAAGTTCAAGGTCCAGAAGGATGG CATCGTAATGAAGGAGGGCAAGATCGATCTATGCGCCGCCATTGATCAGG CCTCCTCCGAAGGTAAGGACATGCTAAAGCTTTTCGGAGCACCTTCCTCC TGTCCGGTGGGCGAGGAGAAGGTGTGCGCCAACGATCACTCCGTGGATCT GAGCAAGTACAAGGCCATGTTGGGCATGGCTCGTGGTCACCTCATCATCG ATTCTGAGGTCAAGCATGACACGGGCAAGTCCTGCATTCATGCCGAAATC GAGATCACCAAGAACTAGTGACGGAATCCGATCGTTGGTCTTATGTTTGT ATTATGAGTCTTGCAAATCATGTAGTTGTAAATACGAGGGCAAAAAAAAA TTGGTAATGCGGTGCACACACAGTGATTAAATATACAGAAAATACCGAAT TGAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 8241755..8242157 | 72..474 | 2015 | 100 | Plus |
chr2L | 23010047 | chr2L | 8242219..8242398 | 473..652 | 900 | 100 | Plus |
chr2L | 23010047 | chr2L | 8241631..8241701 | 1..71 | 355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8241631..8241701 | 1..71 | 100 | -> | Plus |
chr2L | 8241755..8242156 | 72..473 | 100 | -> | Plus |
chr2L | 8242220..8242398 | 474..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 1..510 | 9..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 1..510 | 9..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 1..510 | 9..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 1..510 | 9..518 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 1..644 | 9..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 1..652 | 1..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 28..679 | 1..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14277-RA | 28..679 | 1..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8242659..8242729 | 1..71 | 100 | -> | Plus |
2L | 8242783..8243184 | 72..473 | 100 | -> | Plus |
2L | 8243248..8243426 | 474..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8242659..8242729 | 1..71 | 100 | -> | Plus |
2L | 8242783..8243184 | 72..473 | 100 | -> | Plus |
2L | 8243248..8243426 | 474..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8242659..8242729 | 1..71 | 100 | -> | Plus |
2L | 8242783..8243184 | 72..473 | 100 | -> | Plus |
2L | 8243248..8243426 | 474..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8242659..8242729 | 1..71 | 100 | -> | Plus |
arm_2L | 8242783..8243184 | 72..473 | 100 | -> | Plus |
arm_2L | 8243248..8243426 | 474..652 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8242783..8243184 | 72..473 | 100 | -> | Plus |
2L | 8243248..8243426 | 474..652 | 100 | Plus | |
2L | 8242659..8242729 | 1..71 | 100 | -> | Plus |
Translation from 2 to 517
> LD25250.hyp NIMLRLICVFLLSCVGFQAALACNGYKAKLVKLENCAGEDAIMTVGSDFS LKLNKKCELVPSGCIMNKPFSTAVAKFKVQKDGIVMKEGKIDLCAAIDQA SSEGKDMLKLFGAPSSCPVGEEKVCANDHSVDLSKYKAMLGMARGHLIID SEVKHDTGKSCIHAEIEITKN*
Translation from 2 to 517
> LD25250.pep NIMLRLICVFLLSCVGFQAALACNGYKAKLVKLENCAGEDAIMTVGSDFS LKLNKKCELVPSGCIMNKPFSTAVAKFKVQKDGIVMKEGKIDLCAAIDQA SSEGKDMLKLFGAPSSCPVGEEKVCANDHSVDLSKYKAMLGMARGHLIID SEVKHDTGKSCIHAEIEITKN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14629-PA | 169 | GF14629-PA | 1..169 | 3..171 | 753 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10528-PA | 169 | GG10528-PA | 1..169 | 3..171 | 833 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11585-PA | 157 | GH11585-PA | 1..157 | 15..171 | 658 | 77.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14277-PB | 169 | CG14277-PB | 1..169 | 3..171 | 876 | 100 | Plus |
CG14277-PA | 169 | CG14277-PA | 1..169 | 3..171 | 876 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17154-PA | 169 | GI17154-PA | 7..168 | 9..170 | 635 | 74.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18732-PA | 169 | GL18732-PA | 1..169 | 3..171 | 756 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12876-PA | 169 | GA12876-PA | 1..169 | 3..171 | 756 | 82.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16865-PA | 169 | GM16865-PA | 1..169 | 3..171 | 851 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23518-PA | 169 | GD23518-PA | 1..169 | 3..171 | 851 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17658-PA | 169 | GJ17658-PA | 1..168 | 3..170 | 698 | 76.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23818-PA | 169 | GK23818-PA | 1..169 | 3..171 | 738 | 80.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE18748-PA | 169 | GE18748-PA | 1..169 | 3..171 | 835 | 94.7 | Plus |