Clone LD25271 Report

Search the DGRC for LD25271

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:252
Well:71
Vector:pOT2
Associated Gene/TranscriptCG6617-RA
Protein status:LD25271.pep: gold
Preliminary Size:1075
Sequenced Size:980

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6617 2001-01-01 Release 2 assignment
CG6617 2002-04-04 Blastp of sequenced clone
CG6617 2003-01-01 Sim4 clustering to Release 3
CG6617 2008-04-29 Release 5.5 accounting
CG6617 2008-08-15 Release 5.9 accounting
CG6617 2008-12-18 5.12 accounting

Clone Sequence Records

LD25271.complete Sequence

980 bp (980 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095034

> LD25271.complete
TTTGTGCATTGCAAGTTAGTAAACAATAAAAGCGCATAAACAGGGCTAGG
AAAAGCGGGAAGACGATTAGGTAAACAGAATTCGACGCAAATCGGTTGGA
AAAACGGCCTCAAGATTGGCAAGATACGCAAGAGCAAGAAAATGAGCTAC
AACGAGAAATCGGAGGCCATCATCAAGGAGGAGTGGCTGCAGCGCCTGGA
GCAGTTTCCCTTCAAGCAGGCGGACATGAATCGCCTGATCATGAACTACT
TGGTCACAGAGGGCTTCAAGGAGGCCGCCGAGAAGTTCCAGCACGAGGCG
GATCTGGAGCCCAGCGTGGAGCTGAGCAGCCTCGATGGGCGCATACTCAT
CCGCGAAGCCGTGCAGGCGGGCCGCATCGAGGAGGCCACCCAGCTGGTGA
ACCAGCTGCATCCTGAGCTGCTCGGCAGCGATCGCTATCTGTTCTTCCAC
CTGCAGCAGCTGCAGCTCATCGAGCTGATACGCGCCGGCAAGGTGGAGGA
GGCCCTGTCCTTTGCCCAAAGCAAGCTGTCCGAGTCCGGCGAGGAGGCCA
TGTTTGAGCTGGAGCGCACCCTGGCCCTGCTCGCCTTCGAGAAGCCGCAG
GAGAGCCCCTTCGCCGACCTGCTGGAGCAGTCGTACCGCCAGAAGATCGC
TAGCGAGCTCAACTCGGCCATCCTGCGCTGCGAGCAGAGCGAGGACTCCA
CGCCCAAAATGATGTTCCTGCTCAAGCTGATCTTGTGGGCCCAGTCCAAG
CTGGACAGCCGCTCCATTAGCTATCCCAAGATGAAGAACCTAGAGACGGC
GCACCTGGAGCCCAAGTAGAAGGGCAGCGCCACCCCCTTCGACTTCTTTT
GCTAATGCTATTGCTAATATATCTCCATTTAATAAGTATGTATATGTATG
TATGCTGGATGTAGGCAGTGAATTATTAAATAAGTAGCCGGAAACTCCAT
CACTCCAAAAAAAAAAAAAAAAAAAAAAAA

LD25271.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:15:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG6617-RA 1137 CG6617-RA 141..1097 1..957 4785 100 Plus
CG6540-RA 1301 CG6540-RA 1161..1301 957..817 705 100 Minus
CG18467-RA 1185 CG18467-RA 325..388 216..279 155 82.8 Plus
CG18467-RA 1185 CG18467-RA 844..891 708..755 150 87.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:32:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18538563..18539264 956..255 3510 100 Minus
chrX 22417052 chrX 18539320..18539578 259..1 1295 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:32:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 18649395..18650097 957..255 3515 100 Minus
X 23542271 X 18650153..18650411 259..1 1295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 18657493..18658195 957..255 3515 100 Minus
X 23527363 X 18658251..18658509 259..1 1295 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:32:46 has no hits.

LD25271.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:33:54 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18538563..18539259 260..956 100 <- Minus
chrX 18539320..18539578 1..259 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:14 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 1..678 142..819 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:07:31 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 1..678 142..819 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:09:17 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 1..678 142..819 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:55:42 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 1..678 142..819 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:11:31 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 1..678 142..819 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:44:14 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 30..985 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:07:31 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 36..991 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:09:17 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 34..989 1..956 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:55:42 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 30..985 1..956 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:11:31 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
CG6617-RA 34..989 1..956 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:33:54 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
X 18649396..18650092 260..956 100 <- Minus
X 18650153..18650411 1..259 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:33:54 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
X 18649396..18650092 260..956 100 <- Minus
X 18650153..18650411 1..259 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:33:54 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
X 18649396..18650092 260..956 100 <- Minus
X 18650153..18650411 1..259 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:09:17 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18543429..18544125 260..956 100 <- Minus
arm_X 18544186..18544444 1..259 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:28:03 Download gff for LD25271.complete
Subject Subject Range Query Range Percent Splice Strand
X 18657494..18658190 260..956 100 <- Minus
X 18658251..18658509 1..259 100   Minus

LD25271.hyp Sequence

Translation from 141 to 818

> LD25271.hyp
MSYNEKSEAIIKEEWLQRLEQFPFKQADMNRLIMNYLVTEGFKEAAEKFQ
HEADLEPSVELSSLDGRILIREAVQAGRIEEATQLVNQLHPELLGSDRYL
FFHLQQLQLIELIRAGKVEEALSFAQSKLSESGEEAMFELERTLALLAFE
KPQESPFADLLEQSYRQKIASELNSAILRCEQSEDSTPKMMFLLKLILWA
QSKLDSRSISYPKMKNLETAHLEPK*

LD25271.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:34:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG6617-PA 225 CG6617-PA 1..225 1..225 1119 100 Plus
CG18467-PA 237 CG18467-PA 10..209 15..205 504 48 Plus

LD25271.pep Sequence

Translation from 141 to 818

> LD25271.pep
MSYNEKSEAIIKEEWLQRLEQFPFKQADMNRLIMNYLVTEGFKEAAEKFQ
HEADLEPSVELSSLDGRILIREAVQAGRIEEATQLVNQLHPELLGSDRYL
FFHLQQLQLIELIRAGKVEEALSFAQSKLSESGEEAMFELERTLALLAFE
KPQESPFADLLEQSYRQKIASELNSAILRCEQSEDSTPKMMFLLKLILWA
QSKLDSRSISYPKMKNLETAHLEPK*

LD25271.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22403-PA 225 GF22403-PA 1..225 1..225 1108 95.1 Plus
Dana\GF13121-PA 197 GF13121-PA 10..165 15..205 293 35.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18105-PA 225 GG18105-PA 1..225 1..225 1143 98.7 Plus
Dere\GG20679-PA 237 GG20679-PA 10..223 15..221 528 45.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12808-PA 225 GH12808-PA 1..225 1..225 1047 91.6 Plus
Dgri\GH21398-PA 216 GH21398-PA 1..193 1..210 313 36.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG6617-PA 225 CG6617-PA 1..225 1..225 1119 100 Plus
CG18467-PA 237 CG18467-PA 10..209 15..205 504 48 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15079-PA 225 GI15079-PA 1..225 1..225 1061 92 Plus
Dmoj\GI18577-PA 202 GI18577-PA 10..173 15..205 273 35.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27019-PA 225 GL27019-PA 1..225 1..225 1120 95.6 Plus
Dper\GL11425-PA 231 GL11425-PA 10..221 15..223 586 53.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19727-PA 225 GA19727-PA 1..225 1..225 1120 95.6 Plus
Dpse\GA14944-PA 231 GA14944-PA 10..221 15..223 586 53.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22795-PA 225 GM22795-PA 1..225 1..225 1160 100 Plus
Dsec\GM21774-PA 237 GM21774-PA 10..214 15..210 524 46.3 Plus
Dsec\GM23079-PA 237 GM23079-PA 10..214 15..210 524 46.3 Plus
Dsec\GM16180-PA 217 GM16180-PA 10..194 15..210 482 43.1 Plus
Dsec\GM10398-PA 182 GM10398-PA 1..159 61..210 384 44.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24473-PA 225 GD24473-PA 1..225 1..225 1160 100 Plus
Dsim\GD11267-PA 237 GD11267-PA 10..214 15..210 528 46.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18886-PA 225 GJ18886-PA 1..225 1..225 1078 93.3 Plus
Dvir\GJ20371-PA 211 GJ20371-PA 11..201 15..223 351 38.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10189-PA 225 GK10189-PA 1..225 1..225 1084 92.9 Plus
Dwil\GK22898-PA 212 GK22898-PA 10..205 15..223 351 37.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15506-PA 225 GE15506-PA 1..225 1..225 1143 98.7 Plus
Dyak\GE11662-PA 238 GE11662-PA 10..226 15..223 529 45.2 Plus