Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
LD25448.complete Sequence
1213 bp (1213 high quality bases) assembled on 2002-05-15
GenBank Submission: AY118530
> LD25448.complete
GCAGGAGCAGCAGTCTACAAGAAGTTTTTGATATAGTTCAGACTTTTACT
AGTTTATTTGATGGCTTTTCCCACCACAAGTGCCCAGCAAGCCGAGACGA
ACCGCAAGATACTCGAAGAGATCCAGACGAAGAAGCAGTTGCTCGCGGGC
GGGATCATAAACCTTGGTCTGAGTCCGCCGAACCAGATGCCCGCACCCCA
GTTGCTGGGACAGCCGACGACAGTGAATCCAGACTTCCAGGCGGGCGTGG
GCATTGCCACCAATGCCACATCCACCGCCCGCTCTGCATTTAATCCAACG
AGCTCTACGACTTTGGGCTTCTTTATACCTCAGGATTCGTATTTTGGAAA
TAGCTTTATACCCGTGCTGCCTCGTCTGGAGCCGCTGCCGTCGCCTGCGA
CCACGCCCACTACTCCGAACGCTCCGCCCAGCCACAGTATCAGCAAATAG
CCGGATCCACAATGGCCCGGTTGAAGCTGAGGAAACTGGAGGAGTACCTG
CAGGGCGTTGACGGTTTCGAGCAGCCCAAGATCCTGTTGGAACAGTACCC
CACTCCGCCGCACATAGCCGCGTGCATGGCTCATCACATGCAGTCGCAGC
ACGAGGACATCGAGGGAAAGCTGGTGGGAGATTTGGGCTGCGGCTGCGGA
ATGCTCAGCATTGCTTCCACTCTGCTGGGCGCCCAGCTCACGGTGGGCTT
CGAACTGGACGGCGATGCCGTGGACACCTTTAGGGGCAATGTGGTGGAGA
TGGAGCTACCCAATGTTGACTGCGTGCGGGCGGATGTGCTGCAGCTGATC
GGCAGCAAGTGGGAGAAGTCCTTTGACACGGTGCTGATGAATCCCCCATT
CGGCACGAAACACAATGCCGGCATGGACATGCGGTTTCTGGAGGTGGCCC
TACGGTTGGCCAACAGAGCAGTTTACTCCCTACACAAGACGTCAACACGG
TCGTACATTCAGAAAAAGGCACTGGAATGGGGCGCCCGCGGCTCAGTGGT
CGCCGAACTCCGGTACAACATCGACGCCAGCTACAAGTTTCACAAGCAGA
AGTCGAAGGATATTGAGGTGGACTTCTGGCGCTTTGAAATCGGCACGGAA
TAGGAAGAATTATATCAGTTGCATTTAGTTTTGGACATTATATGTAATAG
TATTGTAAATTGTAGCACATTAAAATTGATCGTATGTGTTTTCTAAAAAA
AAAAAAAAAAAAA
LD25448.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:07:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42374-RA | 1632 | CG42374-RA | 439..1632 | 1..1194 | 5970 | 100 | Plus |
CG9666-RA | 1632 | CG9666-RA | 439..1632 | 1..1194 | 5970 | 100 | Plus |
CG9666-RB | 1030 | CG9666-RB | 167..1030 | 331..1194 | 4320 | 100 | Plus |
CG9666-RB | 1030 | CG9666-RB | 8..169 | 25..186 | 810 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:36:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 19254141..19254907 | 185..951 | 3775 | 99.5 | Plus |
chr3L | 24539361 | chr3L | 19256059..19256304 | 949..1194 | 1200 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 19253899..19254084 | 1..186 | 930 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:36:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 19264679..19265445 | 185..951 | 3835 | 100 | Plus |
3L | 28110227 | 3L | 19266593..19266839 | 949..1195 | 1235 | 100 | Plus |
3L | 28110227 | 3L | 19264437..19264622 | 1..186 | 930 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 19257779..19258545 | 185..951 | 3835 | 100 | Plus |
3L | 28103327 | 3L | 19259693..19259939 | 949..1195 | 1235 | 100 | Plus |
3L | 28103327 | 3L | 19257537..19257722 | 1..186 | 930 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 13:36:43 has no hits.
LD25448.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:38:06 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 19253899..19254084 | 1..186 | 100 | -> | Plus |
chr3L | 19254143..19254905 | 187..949 | 99 | -> | Plus |
chr3L | 19256060..19256304 | 950..1194 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:23 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9666-RB | 1..642 | 462..1103 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:16 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9666-RB | 1..642 | 462..1103 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:06:39 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9666-RA | 1..642 | 462..1103 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:54 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9666-RA | 1..642 | 462..1103 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:35:25 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9666-RA | 1..642 | 462..1103 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:01 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42374-RA | 439..1632 | 1..1194 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:16 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42374-RA | 439..1632 | 1..1194 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:06:39 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG42374-RA | 34..1227 | 1..1194 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:54 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9666-RA | 439..1632 | 1..1194 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:35:25 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG9666-RD | 442..1635 | 1..1194 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:06 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19266594..19266838 | 950..1194 | 100 | | Plus |
3L | 19264437..19264622 | 1..186 | 100 | -> | Plus |
3L | 19264681..19265443 | 187..949 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:06 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19266594..19266838 | 950..1194 | 100 | | Plus |
3L | 19264437..19264622 | 1..186 | 100 | -> | Plus |
3L | 19264681..19265443 | 187..949 | 100 | -> | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:06 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19266594..19266838 | 950..1194 | 100 | | Plus |
3L | 19264437..19264622 | 1..186 | 100 | -> | Plus |
3L | 19264681..19265443 | 187..949 | 100 | -> | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:06:39 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 19257537..19257722 | 1..186 | 100 | -> | Plus |
arm_3L | 19257781..19258543 | 187..949 | 100 | -> | Plus |
arm_3L | 19259694..19259938 | 950..1194 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:12 Download gff for
LD25448.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 19257781..19258543 | 187..949 | 100 | -> | Plus |
3L | 19259694..19259938 | 950..1194 | 100 | | Plus |
3L | 19257537..19257722 | 1..186 | 100 | -> | Plus |
LD25448.pep2 Sequence
Translation from 60 to 449
> LD25448.pep2
MAFPTTSAQQAETNRKILEEIQTKKQLLAGGIINLGLSPPNQMPAPQLLG
QPTTVNPDFQAGVGIATNATSTARSAFNPTSSTTLGFFIPQDSYFGNSFI
PVLPRLEPLPSPATTPTTPNAPPSHSISK*
LD25448.pep2 Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:05:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF23665-PA | 123 | GF23665-PA | 1..115 | 1..116 | 466 | 82.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:05:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16026-PA | 129 | GG16026-PA | 1..129 | 1..129 | 635 | 98.4 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:05:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH17167-PA | 115 | GH17167-PA | 1..108 | 1..111 | 387 | 76.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42374-PB | 129 | CG42374-PB | 1..129 | 1..129 | 665 | 100 | Plus |
CG42374-PA | 129 | CG42374-PA | 1..129 | 1..129 | 665 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:05:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI11782-PA | 115 | GI11782-PA | 1..109 | 1..112 | 374 | 74.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:05:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL20926-PA | 125 | GL20926-PA | 1..108 | 1..109 | 436 | 86.4 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:05:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA28629-PA | 125 | GA28629-PA | 1..108 | 1..109 | 436 | 86.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:05:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15016-PA | 126 | GM15016-PA | 1..126 | 1..129 | 612 | 96.9 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:05:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14793-PA | 129 | GD14793-PA | 1..129 | 1..129 | 645 | 100 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:05:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK20175-PA | 125 | GK20175-PA | 1..103 | 1..107 | 405 | 80.7 | Plus |
Dwil\GK21300-PA | 125 | GK21300-PA | 1..103 | 1..107 | 379 | 75.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:05:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23078-PA | 130 | GE23078-PA | 1..130 | 1..129 | 616 | 96.2 | Plus |
Dyak\GE19595-PA | 130 | GE19595-PA | 1..130 | 1..129 | 616 | 96.2 | Plus |
LD25448.hyp Sequence
Translation from 461 to 1102
> LD25448.hyp
MARLKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDI
EGKLVGDLGCGCGMLSIASTLLGAQLTVGFELDGDAVDTFRGNVVEMELP
NVDCVRADVLQLIGSKWEKSFDTVLMNPPFGTKHNAGMDMRFLEVALRLA
NRAVYSLHKTSTRSYIQKKALEWGARGSVVAELRYNIDASYKFHKQKSKD
IEVDFWRFEIGTE*
LD25448.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9666-PD | 213 | CG9666-PD | 1..213 | 1..213 | 1117 | 100 | Plus |
CG9666-PA | 213 | CG9666-PA | 1..213 | 1..213 | 1117 | 100 | Plus |
LD25448.pep Sequence
Translation from 461 to 1102
> LD25448.pep
MARLKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDI
EGKLVGDLGCGCGMLSIASTLLGAQLTVGFELDGDAVDTFRGNVVEMELP
NVDCVRADVLQLIGSKWEKSFDTVLMNPPFGTKHNAGMDMRFLEVALRLA
NRAVYSLHKTSTRSYIQKKALEWGARGSVVAELRYNIDASYKFHKQKSKD
IEVDFWRFEIGTE*
LD25448.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:33:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF23666-PA | 213 | GF23666-PA | 1..210 | 1..210 | 1054 | 90.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:33:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG16027-PA | 213 | GG16027-PA | 1..211 | 1..211 | 1128 | 98.6 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:33:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH17170-PA | 213 | GH17170-PA | 1..210 | 1..210 | 936 | 80 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG9666-PD | 213 | CG9666-PD | 1..213 | 1..213 | 1117 | 100 | Plus |
CG9666-PA | 213 | CG9666-PA | 1..213 | 1..213 | 1117 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:33:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI11783-PA | 213 | GI11783-PA | 1..210 | 1..210 | 919 | 78.6 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:33:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL20927-PA | 214 | GL20927-PA | 1..210 | 1..210 | 1000 | 85.7 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:33:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA21950-PA | 214 | GA21950-PA | 1..210 | 1..210 | 1000 | 85.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:33:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM15017-PA | 213 | GM15017-PA | 1..213 | 1..213 | 1131 | 97.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:33:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14794-PA | 213 | GD14794-PA | 1..213 | 1..213 | 1141 | 99.1 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:33:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ13484-PA | 213 | GJ13484-PA | 1..211 | 1..211 | 974 | 82 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:33:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK20179-PA | 218 | GK20179-PA | 1..216 | 1..213 | 914 | 77.9 | Plus |
Dwil\GK21301-PA | 100 | GK21301-PA | 1..100 | 39..164 | 281 | 50 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:33:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23079-PA | 213 | GE23079-PA | 1..213 | 1..213 | 1130 | 97.7 | Plus |
Dyak\GE19596-PA | 213 | GE19596-PA | 1..213 | 1..213 | 1126 | 97.2 | Plus |