Clone LD25448 Report

Search the DGRC for LD25448

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:254
Well:48
Vector:pOT2
Associated Gene/TranscriptCG42374-RA
Protein status:LD25448.pep2: gold LD25448.pep: gold
Preliminary Size:1342
Sequenced Size:1213

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9666 2001-01-01 Release 2 assignment
CG9666 2002-05-15 Blastp of sequenced clone
CG9666 2003-01-01 Sim4 clustering to Release 3
CG9666 2008-04-29 Release 5.5 accounting
CG9666 2008-08-15 Release 5.9 accounting
CG9666 2008-12-18 5.12 accounting
CG42374 2008-12-18 5.12 accounting

Clone Sequence Records

LD25448.complete Sequence

1213 bp (1213 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118530

> LD25448.complete
GCAGGAGCAGCAGTCTACAAGAAGTTTTTGATATAGTTCAGACTTTTACT
AGTTTATTTGATGGCTTTTCCCACCACAAGTGCCCAGCAAGCCGAGACGA
ACCGCAAGATACTCGAAGAGATCCAGACGAAGAAGCAGTTGCTCGCGGGC
GGGATCATAAACCTTGGTCTGAGTCCGCCGAACCAGATGCCCGCACCCCA
GTTGCTGGGACAGCCGACGACAGTGAATCCAGACTTCCAGGCGGGCGTGG
GCATTGCCACCAATGCCACATCCACCGCCCGCTCTGCATTTAATCCAACG
AGCTCTACGACTTTGGGCTTCTTTATACCTCAGGATTCGTATTTTGGAAA
TAGCTTTATACCCGTGCTGCCTCGTCTGGAGCCGCTGCCGTCGCCTGCGA
CCACGCCCACTACTCCGAACGCTCCGCCCAGCCACAGTATCAGCAAATAG
CCGGATCCACAATGGCCCGGTTGAAGCTGAGGAAACTGGAGGAGTACCTG
CAGGGCGTTGACGGTTTCGAGCAGCCCAAGATCCTGTTGGAACAGTACCC
CACTCCGCCGCACATAGCCGCGTGCATGGCTCATCACATGCAGTCGCAGC
ACGAGGACATCGAGGGAAAGCTGGTGGGAGATTTGGGCTGCGGCTGCGGA
ATGCTCAGCATTGCTTCCACTCTGCTGGGCGCCCAGCTCACGGTGGGCTT
CGAACTGGACGGCGATGCCGTGGACACCTTTAGGGGCAATGTGGTGGAGA
TGGAGCTACCCAATGTTGACTGCGTGCGGGCGGATGTGCTGCAGCTGATC
GGCAGCAAGTGGGAGAAGTCCTTTGACACGGTGCTGATGAATCCCCCATT
CGGCACGAAACACAATGCCGGCATGGACATGCGGTTTCTGGAGGTGGCCC
TACGGTTGGCCAACAGAGCAGTTTACTCCCTACACAAGACGTCAACACGG
TCGTACATTCAGAAAAAGGCACTGGAATGGGGCGCCCGCGGCTCAGTGGT
CGCCGAACTCCGGTACAACATCGACGCCAGCTACAAGTTTCACAAGCAGA
AGTCGAAGGATATTGAGGTGGACTTCTGGCGCTTTGAAATCGGCACGGAA
TAGGAAGAATTATATCAGTTGCATTTAGTTTTGGACATTATATGTAATAG
TATTGTAAATTGTAGCACATTAAAATTGATCGTATGTGTTTTCTAAAAAA
AAAAAAAAAAAAA

LD25448.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:07:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG42374-RA 1632 CG42374-RA 439..1632 1..1194 5970 100 Plus
CG9666-RA 1632 CG9666-RA 439..1632 1..1194 5970 100 Plus
CG9666-RB 1030 CG9666-RB 167..1030 331..1194 4320 100 Plus
CG9666-RB 1030 CG9666-RB 8..169 25..186 810 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19254141..19254907 185..951 3775 99.5 Plus
chr3L 24539361 chr3L 19256059..19256304 949..1194 1200 99.2 Plus
chr3L 24539361 chr3L 19253899..19254084 1..186 930 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19264679..19265445 185..951 3835 100 Plus
3L 28110227 3L 19266593..19266839 949..1195 1235 100 Plus
3L 28110227 3L 19264437..19264622 1..186 930 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19257779..19258545 185..951 3835 100 Plus
3L 28103327 3L 19259693..19259939 949..1195 1235 100 Plus
3L 28103327 3L 19257537..19257722 1..186 930 100 Plus
Blast to na_te.dros performed on 2019-03-15 13:36:43 has no hits.

LD25448.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:38:06 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19253899..19254084 1..186 100 -> Plus
chr3L 19254143..19254905 187..949 99 -> Plus
chr3L 19256060..19256304 950..1194 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:23 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG9666-RB 1..642 462..1103 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:16 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG9666-RB 1..642 462..1103 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:06:39 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG9666-RA 1..642 462..1103 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:54 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG9666-RA 1..642 462..1103 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:35:25 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG9666-RA 1..642 462..1103 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:01 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG42374-RA 439..1632 1..1194 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:16 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG42374-RA 439..1632 1..1194 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:06:39 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG42374-RA 34..1227 1..1194 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:54 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG9666-RA 439..1632 1..1194 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:35:25 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
CG9666-RD 442..1635 1..1194 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:06 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19266594..19266838 950..1194 100   Plus
3L 19264437..19264622 1..186 100 -> Plus
3L 19264681..19265443 187..949 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:06 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19266594..19266838 950..1194 100   Plus
3L 19264437..19264622 1..186 100 -> Plus
3L 19264681..19265443 187..949 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:06 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19266594..19266838 950..1194 100   Plus
3L 19264437..19264622 1..186 100 -> Plus
3L 19264681..19265443 187..949 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:06:39 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19257537..19257722 1..186 100 -> Plus
arm_3L 19257781..19258543 187..949 100 -> Plus
arm_3L 19259694..19259938 950..1194 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:12 Download gff for LD25448.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19257781..19258543 187..949 100 -> Plus
3L 19259694..19259938 950..1194 100   Plus
3L 19257537..19257722 1..186 100 -> Plus

LD25448.pep2 Sequence

Translation from 60 to 449

> LD25448.pep2
MAFPTTSAQQAETNRKILEEIQTKKQLLAGGIINLGLSPPNQMPAPQLLG
QPTTVNPDFQAGVGIATNATSTARSAFNPTSSTTLGFFIPQDSYFGNSFI
PVLPRLEPLPSPATTPTTPNAPPSHSISK*

LD25448.pep2 Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 23:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23665-PA 123 GF23665-PA 1..115 1..116 466 82.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 23:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16026-PA 129 GG16026-PA 1..129 1..129 635 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 23:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17167-PA 115 GH17167-PA 1..108 1..111 387 76.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42374-PB 129 CG42374-PB 1..129 1..129 665 100 Plus
CG42374-PA 129 CG42374-PA 1..129 1..129 665 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 23:05:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11782-PA 115 GI11782-PA 1..109 1..112 374 74.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 23:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20926-PA 125 GL20926-PA 1..108 1..109 436 86.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 23:05:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28629-PA 125 GA28629-PA 1..108 1..109 436 86.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 23:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15016-PA 126 GM15016-PA 1..126 1..129 612 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 23:05:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14793-PA 129 GD14793-PA 1..129 1..129 645 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 23:05:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20175-PA 125 GK20175-PA 1..103 1..107 405 80.7 Plus
Dwil\GK21300-PA 125 GK21300-PA 1..103 1..107 379 75.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 23:05:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23078-PA 130 GE23078-PA 1..130 1..129 616 96.2 Plus
Dyak\GE19595-PA 130 GE19595-PA 1..130 1..129 616 96.2 Plus

LD25448.hyp Sequence

Translation from 461 to 1102

> LD25448.hyp
MARLKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDI
EGKLVGDLGCGCGMLSIASTLLGAQLTVGFELDGDAVDTFRGNVVEMELP
NVDCVRADVLQLIGSKWEKSFDTVLMNPPFGTKHNAGMDMRFLEVALRLA
NRAVYSLHKTSTRSYIQKKALEWGARGSVVAELRYNIDASYKFHKQKSKD
IEVDFWRFEIGTE*

LD25448.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:23:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9666-PD 213 CG9666-PD 1..213 1..213 1117 100 Plus
CG9666-PA 213 CG9666-PA 1..213 1..213 1117 100 Plus

LD25448.pep Sequence

Translation from 461 to 1102

> LD25448.pep
MARLKLRKLEEYLQGVDGFEQPKILLEQYPTPPHIAACMAHHMQSQHEDI
EGKLVGDLGCGCGMLSIASTLLGAQLTVGFELDGDAVDTFRGNVVEMELP
NVDCVRADVLQLIGSKWEKSFDTVLMNPPFGTKHNAGMDMRFLEVALRLA
NRAVYSLHKTSTRSYIQKKALEWGARGSVVAELRYNIDASYKFHKQKSKD
IEVDFWRFEIGTE*

LD25448.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:33:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23666-PA 213 GF23666-PA 1..210 1..210 1054 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16027-PA 213 GG16027-PA 1..211 1..211 1128 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:33:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17170-PA 213 GH17170-PA 1..210 1..210 936 80 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG9666-PD 213 CG9666-PD 1..213 1..213 1117 100 Plus
CG9666-PA 213 CG9666-PA 1..213 1..213 1117 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11783-PA 213 GI11783-PA 1..210 1..210 919 78.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:33:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20927-PA 214 GL20927-PA 1..210 1..210 1000 85.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21950-PA 214 GA21950-PA 1..210 1..210 1000 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:33:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15017-PA 213 GM15017-PA 1..213 1..213 1131 97.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14794-PA 213 GD14794-PA 1..213 1..213 1141 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:33:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13484-PA 213 GJ13484-PA 1..211 1..211 974 82 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20179-PA 218 GK20179-PA 1..216 1..213 914 77.9 Plus
Dwil\GK21301-PA 100 GK21301-PA 1..100 39..164 281 50 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:33:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23079-PA 213 GE23079-PA 1..213 1..213 1130 97.7 Plus
Dyak\GE19596-PA 213 GE19596-PA 1..213 1..213 1126 97.2 Plus