Clone LD25561 Report

Search the DGRC for LD25561

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:255
Well:61
Vector:pOT2
Associated Gene/TranscriptNDUFS3-RA
Protein status:LD25561.pep: gold
Preliminary Size:1074
Sequenced Size:950

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12079 2001-01-01 Release 2 assignment
CG12079 2002-05-15 Blastp of sequenced clone
CG12079 2003-01-01 Sim4 clustering to Release 3
CG12079 2008-04-29 Release 5.5 accounting
CG12079 2008-08-15 Release 5.9 accounting
CG12079 2008-12-18 5.12 accounting

Clone Sequence Records

LD25561.complete Sequence

950 bp (950 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118532

> LD25561.complete
ACATTTTAGCATTACACATTGTCAAAAACGGAGCAAATTGTTGAATTTAT
ATTGAACAGTTTGTAGAATGGCGGCCTTAATCAGGAATCTGGGTGCCCGT
GCCGCAGTCGCCGCTCTGTCGGCCAAACATGTGGTGCCCGCTGCTGGATC
CACTGCTCTTCGGATGGCCAGTACAACGCCAGTGGAGCCTAAGAAGGCGG
ATAAGCCCACTGTCCGCCAGCCGGACGCAGTCGCTCGCTCGCATCTCTCC
GATTTCGGGCGCTATGTGGCCGAGTGCCTGCCCAAGTACGTGCAGAAGGT
GCAGCTGACCGCCGGCGATGAGCTGGAGGTGCTTATTGCGCCAGAGGGCG
TGGTGCCCGTGCTGCAGTTCCTTAAGGATCATCATCAGGCGCAGTTTACC
AACCTGGTTGACATTGCCGGCGTGGATGTGCCCTGTCGCAAGAACCGATT
CGAGGTGGTCTACAATTTGCTCTCGCTGCGCTACAATTCGCGCATCCGCG
TTAAGACCTACACCGATGAGCTGACTCCTCTGGACTCCGCCTGCGAGGTG
CATAAGGCGGCCAACTGGTACGAACGTGAGATCTGGGACATGTACGGCGT
GTTCTTTGCCAACCATCCCGACTTGCGCCGCATCCTGACCGATTACGGTT
TTGAGGGACATCCCCAGCGCCGCGACTTCCCGCTGTCCGGCTACGTAGAG
CTGCGCTACGATGATGAGAAGAAGCGAGTCGTCTGCGAGCCCTTGGAGTT
GGCCCAGGAGTTCAGGAAGTTTGACTTGTCGGCGCCTTGGGAACAGTTCC
CCAACTTCCGCAACGCTAATCCCCCCGCCGAGGTAGTTCCGCCACAGGCT
CCAGCCAAGAAGTAATCCGAAGTCGGTTTGTTAAATGGTAATTAGATCAA
TAAAACGTGATCACTATGAGATGTTTAAACATAAAAAAAAAAAAAAAAAA

LD25561.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12079-RA 1060 CG12079-RA 83..1018 1..934 4610 99.6 Plus
CG12079.b 997 CG12079.b 55..994 1..934 4545 99.2 Plus
CG12079.a 997 CG12079.a 55..994 1..934 4545 99.2 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:43:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3157937..3158662 932..207 3615 99.9 Minus
chr3L 24539361 chr3L 3158856..3158988 131..1 585 97.7 Minus
chr3L 24539361 chr3L 3158721..3158796 206..131 380 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:35 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:43:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3158488..3159215 934..207 3640 100 Minus
3L 28110227 3L 3159409..3159541 131..1 585 97.7 Minus
3L 28110227 3L 3159274..3159349 206..131 380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3158488..3159215 934..207 3640 100 Minus
3L 28103327 3L 3159409..3159541 131..1 595 97.7 Minus
3L 28103327 3L 3159274..3159349 206..131 380 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:43:55 has no hits.

LD25561.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:44:55 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3158721..3158795 132..206 100 <- Minus
chr3L 3158856..3158988 1..131 97   Minus
chr3L 3157937..3158662 207..932 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:33 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 1..798 68..865 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:17 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 1..798 68..865 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:07:16 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 1..798 68..865 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:55 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 1..798 68..865 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:15:28 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
NDUFS3-RA 1..798 68..865 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:03 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 33..966 1..932 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:17 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 33..966 1..932 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:07:16 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 38..971 1..932 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:55 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
CG12079-RA 33..966 1..932 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:15:28 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
NDUFS3-RA 38..971 1..932 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:44:55 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3158490..3159215 207..932 100 <- Minus
3L 3159274..3159348 132..206 100 <- Minus
3L 3159409..3159541 1..131 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:44:55 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3158490..3159215 207..932 100 <- Minus
3L 3159274..3159348 132..206 100 <- Minus
3L 3159409..3159541 1..131 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:44:55 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3158490..3159215 207..932 100 <- Minus
3L 3159274..3159348 132..206 100 <- Minus
3L 3159409..3159541 1..131 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:07:16 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3158490..3159215 207..932 100 <- Minus
arm_3L 3159274..3159348 132..206 100 <- Minus
arm_3L 3159409..3159541 1..131 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:13 Download gff for LD25561.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3158490..3159215 207..932 100 <- Minus
3L 3159274..3159348 132..206 100 <- Minus
3L 3159409..3159541 1..131 97   Minus

LD25561.hyp Sequence

Translation from 67 to 864

> LD25561.hyp
MAALIRNLGARAAVAALSAKHVVPAAGSTALRMASTTPVEPKKADKPTVR
QPDAVARSHLSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQ
FLKDHHQAQFTNLVDIAGVDVPCRKNRFEVVYNLLSLRYNSRIRVKTYTD
ELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQ
RRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNA
NPPAEVVPPQAPAKK*

LD25561.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
NDUFS3-PA 265 CG12079-PA 1..265 1..265 1394 100 Plus

LD25561.pep Sequence

Translation from 67 to 864

> LD25561.pep
MAALIRNLGARAAVAALSAKHVVPAAGSTALRMASTTPVEPKKADKPTVR
QPDAVARSHLSDFGRYVAECLPKYVQKVQLTAGDELEVLIAPEGVVPVLQ
FLKDHHQAQFTNLVDIAGVDVPCRKNRFEVVYNLLSLRYNSRIRVKTYTD
ELTPLDSACEVHKAANWYEREIWDMYGVFFANHPDLRRILTDYGFEGHPQ
RRDFPLSGYVELRYDDEKKRVVCEPLELAQEFRKFDLSAPWEQFPNFRNA
NPPAEVVPPQAPAKK*

LD25561.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10219-PA 261 GF10219-PA 1..261 1..265 1259 93.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14478-PA 265 GG14478-PA 1..265 1..265 1401 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16082-PA 261 GH16082-PA 1..258 1..259 1246 87.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
ND-30-PA 265 CG12079-PA 1..265 1..265 1394 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12345-PA 267 GI12345-PA 1..258 1..259 1266 91.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:01:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20750-PA 266 GL20750-PA 1..266 1..265 1294 90.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11380-PA 266 GA11380-PA 1..266 1..265 1297 90.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14080-PA 265 GM14080-PA 1..265 1..265 1398 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13354-PA 265 GD13354-PA 1..265 1..265 1402 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12236-PA 267 GJ12236-PA 1..258 1..259 1268 91.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18031-PA 266 GK18031-PA 1..266 1..265 1305 91 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21665-PA 265 GE21665-PA 1..265 1..265 1394 98.5 Plus