Clone LD25772 Report

Search the DGRC for LD25772

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:257
Well:72
Vector:pOT2
Associated Gene/TranscriptCG12304-RB
Protein status:LD25772.pep: gold
Preliminary Size:1059
Sequenced Size:1015

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12304 2003-02-22 Blastp of sequenced clone
CG12304 2008-04-29 Release 5.5 accounting
CG12304 2008-08-15 Release 5.9 accounting
CG12304 2008-12-18 5.12 accounting

Clone Sequence Records

LD25772.complete Sequence

1015 bp assembled on 2006-11-09

GenBank Submission: AY069537

> LD25772.complete
CAGGTTATTGTGTTTATCCAACGATTCTCGCCGCGAAAATGTACGAACTG
AAGACTCTGCTGCCGCAATTCGACATAAAGCTGCCCACCTGCATGTATCC
TCTCAAGAACGTTAGCCTGGCGGCGGATTCCTTGGCCAGCGGCTCCTCCA
CATCCGCATCCACATCCGCGTCCACATCATCATGCGACGATACGGCATCA
GTGGCCGCCCGACAGGAGAAGGTTCTCAAGCAGCTGGAGGAGCTGAAGGC
GCAGCTGGGACAAATCCGGGCGGGACTTGGTGTTTGTGGCAAGACTTTCC
AGCACACGACTGCTTTCCAGAATGGTGGATTAAAGGAGGTGCCACTGCAG
GATGTCGTCATCAATGGACATCCCAACTTCATACCCTATGCCTTGTTGGC
CCTGAAAAATGCCTGGCGCAATCTGTACACTATTGATGTCAAGACCTTTA
CGCACTCTACGATGGCCGACATTGGACCAGCAGCACGGGAATTCGAGGCC
AACTTGGCGAAGGTTCCAGTAAACCCTGCTTTGCCCAAGATTAGTGTGAC
GCTCATCTGGAAGAACTGCGAACACACCGAGATGATCAGCTCGCCCACCA
TGTACGTGCCCATCTACGGAGAGGTGAACATCATTCGCTATCTGGGCCGT
GTGGGTCCAGCCGAGTATCGTTATGAGGGCTCTCCGCTCTGCAATGAGAT
CGACCTTGTCCTGGACATTTGCTACCAACTGCTGCGCTGCAACACGCACA
AAACGCAGGTGGCCATGGTGCGCCTGCTGGACAAGCGACTGCAGAAGCAG
CAGTATTTCGGTGGATCCCAGATGTCGGTGGCGGATGTCGGTGTCTACAG
CTCACTGATACGCATGCCAGCTGTTACCGAGAAGGATCTGACGCCTGCGC
TAGTGGCTTGGAGAAAAAGGGCCAAGCTCGTGGTTCAAATTTAAATAATT
CAATCGACAAAGGCGAACAAATAAATTATAGAATTCAATGTGAAAAAAAA
AAAAAAAAAAAAAAA

LD25772.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-RB 1241 CG12304-RB 176..1168 1..993 4965 100 Plus
CG12304-RA 1340 CG12304-RA 460..1267 186..993 4040 100 Plus
CG12304-RA 1340 CG12304-RA 176..360 1..185 925 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:01:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15574852..15575276 568..992 2095 99.5 Plus
chr3L 24539361 chr3L 15574567..15574798 337..568 1160 100 Plus
chr3L 24539361 chr3L 15573627..15573812 1..186 930 100 Plus
chr3L 24539361 chr3L 15574216..15574370 186..340 775 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:17:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:01:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15584923..15585348 568..993 2130 100 Plus
3L 28110227 3L 15584638..15584869 337..568 1160 100 Plus
3L 28110227 3L 15583697..15583882 1..186 930 100 Plus
3L 28110227 3L 15584287..15584441 186..340 775 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:22
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15578023..15578448 568..993 2130 100 Plus
3L 28103327 3L 15577738..15577969 337..568 1160 100 Plus
3L 28103327 3L 15576797..15576982 1..186 930 100 Plus
3L 28103327 3L 15577387..15577541 186..340 775 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:01:16 has no hits.

LD25772.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:02:01 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15574569..15574797 339..567 100 -> Plus
chr3L 15573627..15573772 1..146 100 == Plus
chr3L 15574216..15574368 186..338 100 -> Plus
chr3L 15574852..15575276 568..992 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:04:49 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 1..906 39..944 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:19:40 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 1..906 39..944 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:57 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 1..906 39..944 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:36:02 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 1..906 39..944 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:25 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 1..906 39..944 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:03 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 55..1046 1..992 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:19:40 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 55..1046 1..992 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:57 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 60..1051 1..992 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:36:03 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 55..1043 1..989 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:25 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
CG12304-RB 60..1051 1..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:01 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15583697..15583881 1..185 100 -> Plus
3L 15584287..15584439 186..338 100 -> Plus
3L 15584640..15584868 339..567 100 -> Plus
3L 15584923..15585347 568..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:01 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15583697..15583881 1..185 100 -> Plus
3L 15584287..15584439 186..338 100 -> Plus
3L 15584640..15584868 339..567 100 -> Plus
3L 15584923..15585347 568..992 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:02:01 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15583697..15583881 1..185 100 -> Plus
3L 15584287..15584439 186..338 100 -> Plus
3L 15584640..15584868 339..567 100 -> Plus
3L 15584923..15585347 568..992 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:57 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15576797..15576981 1..185 100 -> Plus
arm_3L 15577387..15577539 186..338 100 -> Plus
arm_3L 15577740..15577968 339..567 100 -> Plus
arm_3L 15578023..15578447 568..992 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:48:59 Download gff for LD25772.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15576797..15576981 1..185 100 -> Plus
3L 15577387..15577539 186..338 100 -> Plus
3L 15577740..15577968 339..567 100 -> Plus
3L 15578023..15578447 568..992 100   Plus

LD25772.hyp Sequence

Translation from 2 to 943

> LD25772.hyp
GYCVYPTILAAKMYELKTLLPQFDIKLPTCMYPLKNVSLAADSLASGSST
SASTSASTSSCDDTASVAARQEKVLKQLEELKAQLGQIRAGLGVCGKTFQ
HTTAFQNGGLKEVPLQDVVINGHPNFIPYALLALKNAWRNLYTIDVKTFT
HSTMADIGPAAREFEANLAKVPVNPALPKISVTLIWKNCEHTEMISSPTM
YVPIYGEVNIIRYLGRVGPAEYRYEGSPLCNEIDLVLDICYQLLRCNTHK
TQVAMVRLLDKRLQKQQYFGGSQMSVADVGVYSSLIRMPAVTEKDLTPAL
VAWRKRAKLVVQI*

LD25772.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:04:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG12304-PB 301 CG12304-PB 1..301 13..313 1547 100 Plus
CG12304-PA 334 CG12304-PA 1..334 13..313 1503 90.1 Plus

LD25772.pep Sequence

Translation from 38 to 943

> LD25772.pep
MYELKTLLPQFDIKLPTCMYPLKNVSLAADSLASGSSTSASTSASTSSCD
DTASVAARQEKVLKQLEELKAQLGQIRAGLGVCGKTFQHTTAFQNGGLKE
VPLQDVVINGHPNFIPYALLALKNAWRNLYTIDVKTFTHSTMADIGPAAR
EFEANLAKVPVNPALPKISVTLIWKNCEHTEMISSPTMYVPIYGEVNIIR
YLGRVGPAEYRYEGSPLCNEIDLVLDICYQLLRCNTHKTQVAMVRLLDKR
LQKQQYFGGSQMSVADVGVYSSLIRMPAVTEKDLTPALVAWRKRAKLVVQ
I*

LD25772.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24083-PA 336 GF24083-PA 1..336 1..301 1448 81.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15913-PA 334 GG15913-PA 1..334 1..301 1539 87.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17081-PA 291 GH17081-PA 1..291 1..301 1325 81.8 Plus
Dgri\GH23308-PA 332 GH23308-PA 1..332 1..301 1324 75.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:14
Subject Length Description Subject Range Query Range Score Percent Strand
AIMP2-PB 301 CG12304-PB 1..301 1..301 1547 100 Plus
AIMP2-PA 334 CG12304-PA 1..334 1..301 1503 90.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11682-PA 329 GI11682-PA 1..329 1..301 1281 73.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:35:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24943-PA 326 GL24943-PA 1..326 1..301 1384 79.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:35:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11544-PA 326 GA11544-PA 1..326 1..301 1378 79.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25545-PA 334 GM25545-PA 1..334 1..301 1552 88.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:36:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14558-PA 334 GD14558-PA 1..334 1..301 1546 88 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11354-PA 329 GJ11354-PA 1..329 1..301 1340 77.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:36:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20455-PA 340 GK20455-PA 1..340 1..301 1328 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:36:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22257-PA 334 GE22257-PA 1..334 1..301 1537 87.4 Plus
Dyak\GE19834-PA 544 GE19834-PA 1..296 1..263 1355 87.5 Plus