Clone LD25963 Report

Search the DGRC for LD25963

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:259
Well:63
Vector:pOT2
Associated Gene/TranscriptCG8525-RA
Protein status:LD25963.pep: gold
Preliminary Size:1372
Sequenced Size:1243

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8525 2001-10-10 Blastp of sequenced clone
CG8525 2008-04-29 Release 5.5 accounting
CG8525 2008-08-15 Release 5.9 accounting
CG8525 2008-12-18 5.12 accounting

Clone Sequence Records

LD25963.complete Sequence

1243 bp (1243 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061335

> LD25963.complete
CGGCGATCGAACGATTTTATCTTCAAGTGGAATTTAGTCAGCTAAATTTT
CGTTTGACAGCAATGAGCAGCATGGATGTGAAGGAATTGGAAGTAAACAA
AACCCTGCCCTATGATCCCTCCCTGCTTAAGGTAAACATCTCGCTGCGGC
AGGTCGAGGAGATCGCTTTGACGGTGTCCCAGCGATGCCATGTCACCGGA
GCCAACGAAATCGCCTGGGCGCTGAGGGCTCTGATGCTGACAGATCTTAC
CACCTTGGCGGGCGATGATACGGCTGCCAATGTGCGGAGACTATGCCTAC
GCGCCTGCTATCCCTTCGAGCCGCAGTTCTTTGACAAGTTCTTCGACCGG
GCTCTCATCCCAGAGATGCACACGGCCGCCGTTTGCGTTTATCCCGCCAG
GGTAAAGGACGCCTATTTAGCTATCCAACAGTACGACAAACTGGATAAGG
TGGCTATTGCAGCGGTGGCCACGGGATTTCCCACGGGCCAGTACGGCCTG
CAGACCCGCCTGCAGGAGATCAGCCACGCCATTCTTGCTGGAGCCACAGA
GATCGACATTGTGATCAATCGCCAGTTGGCCCTCGTTGGCGACTGGGAGG
CCATGTACAACGAGGTGGTCCTTATGCGCAGTGCCTGTGGACAAAGGGCT
CACCTAAAAACAATTCTGGCCATCGGGGAGCTGGGCACCATGGATAATGT
TTACAAAGCAGCCATGGTTTGCATGATGGCCGGAGCGGATTTTATCAAGA
CCTCAACGGGAAAGGAGACAGTCAACGCCACCCTGCCCGTTGGCCTGGTC
ATGATATTTGCCATTCAGGAATTCAAACGACGCACGTGCCAGATTGTGGG
CCTTAAGCCAGCCGGAGGAGTAAAGACTGTACGAGATGCGATCGCCTGGA
TGACGTTGGTCAACGAAACTCTTGGCATCCGCTGGTTGCGTCCCGAGAGG
TTCCGTTTCGGAGCCTCCGGATTGCTGGACGACATTGAACGCGTTGTGCG
TCAGGGTGTCAAAAAACTCGAGGAGGATGAGGCTCAGAAAAATGTGCCCG
TGTCTCGCGAGGCTGCTGCTGCCGAGACCTTCTGCAAGGAGCTGCGGAAG
AAGTAGGAGGAGGCCAACTGGTCGAATCCGTATTCTGGACTTTACTCACT
CTAAGTGCATTTATTGTAGCTTTTTTATACAACTGACTAAAACCTATAGC
AAAAAAAACCGCAAAAAAAAATTTAAAAAAAAAAAAAAAAAAA

LD25963.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8525-RA 1409 CG8525-RA 192..1404 1..1213 6065 100 Plus
CG8525.a 1341 CG8525.a 182..1336 59..1213 5775 100 Plus
CG8525.b 1322 CG8525.b 163..1317 59..1213 5775 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8313063..8313649 114..700 2935 100 Plus
chr2R 21145070 chr2R 8313710..8314224 699..1213 2575 100 Plus
chr2R 21145070 chr2R 8312897..8313010 1..114 570 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12425815..12426401 114..700 2935 100 Plus
2R 25286936 2R 12426462..12426976 699..1213 2575 100 Plus
2R 25286936 2R 12425649..12425762 1..114 570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12427014..12427600 114..700 2935 100 Plus
2R 25260384 2R 12427661..12428175 699..1213 2575 100 Plus
2R 25260384 2R 12426848..12426961 1..114 570 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:39:00 has no hits.

LD25963.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:40:10 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8312897..8313010 1..114 100 -> Plus
chr2R 8313064..8313647 115..698 100 -> Plus
chr2R 8313710..8314224 699..1213 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:04 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 1..1044 63..1106 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:29 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 1..1044 63..1106 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:31:47 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 1..1044 63..1106 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:38 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 1..1044 63..1106 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:37:33 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 1..1044 63..1106 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:29 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 192..1391 1..1200 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:29 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 167..1378 1..1212 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:31:47 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 167..1378 1..1212 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:38 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 192..1391 1..1200 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:37:33 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
CG8525-RA 167..1378 1..1212 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:10 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12425816..12426399 115..698 100 -> Plus
2R 12426462..12426976 699..1213 100   Plus
2R 12425649..12425762 1..114 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:10 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12425816..12426399 115..698 100 -> Plus
2R 12426462..12426976 699..1213 100   Plus
2R 12425649..12425762 1..114 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:40:10 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12425816..12426399 115..698 100 -> Plus
2R 12426462..12426976 699..1213 100   Plus
2R 12425649..12425762 1..114 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:31:47 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8313154..8313267 1..114 100 -> Plus
arm_2R 8313321..8313904 115..698 100 -> Plus
arm_2R 8313967..8314481 699..1213 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:49 Download gff for LD25963.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12427015..12427598 115..698 100 -> Plus
2R 12427661..12428175 699..1213 100   Plus
2R 12426848..12426961 1..114 100 -> Plus

LD25963.hyp Sequence

Translation from 2 to 1105

> LD25963.hyp
AIERFYLQVEFSQLNFRLTAMSSMDVKELEVNKTLPYDPSLLKVNISLRQ
VEEIALTVSQRCHVTGANEIAWALRALMLTDLTTLAGDDTAANVRRLCLR
ACYPFEPQFFDKFFDRALIPEMHTAAVCVYPARVKDAYLAIQQYDKLDKV
AIAAVATGFPTGQYGLQTRLQEISHAILAGATEIDIVINRQLALVGDWEA
MYNEVVLMRSACGQRAHLKTILAIGELGTMDNVYKAAMVCMMAGADFIKT
STGKETVNATLPVGLVMIFAIQEFKRRTCQIVGLKPAGGVKTVRDAIAWM
TLVNETLGIRWLRPERFRFGASGLLDDIERVVRQGVKKLEEDEAQKNVPV
SREAAAAETFCKELRKK*

LD25963.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:06:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG8525-PD 347 CG8525-PD 1..347 21..367 1764 100 Plus
CG8525-PA 347 CG8525-PA 1..347 21..367 1764 100 Plus

LD25963.pep Sequence

Translation from 62 to 1105

> LD25963.pep
MSSMDVKELEVNKTLPYDPSLLKVNISLRQVEEIALTVSQRCHVTGANEI
AWALRALMLTDLTTLAGDDTAANVRRLCLRACYPFEPQFFDKFFDRALIP
EMHTAAVCVYPARVKDAYLAIQQYDKLDKVAIAAVATGFPTGQYGLQTRL
QEISHAILAGATEIDIVINRQLALVGDWEAMYNEVVLMRSACGQRAHLKT
ILAIGELGTMDNVYKAAMVCMMAGADFIKTSTGKETVNATLPVGLVMIFA
IQEFKRRTCQIVGLKPAGGVKTVRDAIAWMTLVNETLGIRWLRPERFRFG
ASGLLDDIERVVRQGVKKLEEDEAQKNVPVSREAAAAETFCKELRKK*

LD25963.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12866-PA 349 GF12866-PA 1..338 4..341 1628 88.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20303-PA 346 GG20303-PA 1..346 1..346 1800 96.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21204-PA 336 GH21204-PA 2..324 4..326 1442 82 Plus
Dgri\GH20704-PA 320 GH20704-PA 7..319 9..321 1334 78.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG8525-PD 347 CG8525-PD 1..347 1..347 1764 100 Plus
CG8525-PA 347 CG8525-PA 1..347 1..347 1764 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20493-PA 352 GI20493-PA 1..347 4..347 1471 78.1 Plus
Dmoj\GI19065-PA 314 GI19065-PA 3..312 9..318 1263 74.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:04:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11189-PA 349 GL11189-PA 1..344 4..346 1578 88.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21137-PA 349 GA21137-PA 1..344 4..346 1578 88.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:04:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21390-PA 347 GM21390-PA 1..347 1..347 1838 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10886-PA 347 GD10886-PA 1..347 1..347 1843 99.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22343-PA 349 GJ22343-PA 1..346 4..347 1495 80.6 Plus
Dvir\GJ20036-PA 316 GJ20036-PA 2..315 8..321 1233 71.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20798-PA 351 GK20798-PA 1..347 4..347 1635 87.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:04:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12463-PA 347 GE12463-PA 1..347 1..347 1802 96.5 Plus