Clone LD26105 Report

Search the DGRC for LD26105

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:261
Well:5
Vector:pOT2
Associated Gene/TranscriptCG10591-RA
Protein status:LD26105.pep: gold
Preliminary Size:1222
Sequenced Size:1076

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10591 2001-01-01 Release 2 assignment
CG10591 2002-06-12 Blastp of sequenced clone
CG10591 2003-01-01 Sim4 clustering to Release 3
CG10591 2008-04-29 Release 5.5 accounting
CG10591 2008-08-15 Release 5.9 accounting
CG10591 2008-12-18 5.12 accounting

Clone Sequence Records

LD26105.complete Sequence

1076 bp (1076 high quality bases) assembled on 2002-06-12

GenBank Submission: AY122168

> LD26105.complete
AGAAATCCGAAGTACATCATGAGTTTTTTGGGACTCTTGGCTTTTCTGGT
TGCTGGTCTTTGCTCCACCGCCCAGGCTTCGTTGGTGAAATGCTCTTGTG
ATCCTGGTCCACAGGGGGAACGAGGACCTCCAGGTCCGCCTGGACCTCCT
GGCAATCAGAACGGTCTCTCTGGCAGTGGTTCTGGCTACTGGGGCTATCC
ACCCACAGGTCCTTACCCCCCAAATCTGCCTTTCATCCAGGGGCCTAGAG
GCTTACCAGGACCGCCTGGTCCTCCTGGATATTGTTTCCCATGCCCAGCT
CCTCCACCTTTGAGATCCTTTCCGCCACCGGGAGTTCCAGTCCCTCCTTT
CATTTCCACCCCAGGTGGTGGCGGATTTGGTGGAGCCTCTGCATTGACCA
CCGCTGTGGGCAACATTATAGTGATTCCAGGAGGACCAGGAACGGGATTA
GCTGGTCGCGCTCAGTTCTTCCACATTTCACCCGATGGCCAGGTGGTGCA
GATCGATCGACCGCAGAATCTGCCCAGTGAACTGTTCGATACACCGGTGA
ACCAAGGTTCCGGTGCTCCCATTCCTCCACCGCAACCCACATCGTCATCT
CTCTCGGGGATCACACCACCAGCAGTCCAAGTGCCACCAACTCAACCCAC
GCCCGGCGATCTGGGAGCCCAGCAGCCCACAATTTTGCCCGAGAATATGG
AGGAAACTGTGTTTGCGGTTGGCAATCGCAAGGACTTCCTGCGAGGTAGC
TCCGATGCCAGCGATTGGAGAAGGATTCTCCTCCTGGGAGAGCGACCCAC
CGATGGTCTACTCAAGGGCCAGTCCGTCCAGCAGCTCAGTCCCAACCAGC
TCGAGAGCAGCGTGGAGAACTTCCAGAGGGCTTTGGTCGAACTGAAGGAG
AAGTATGCCACGCTCATCCAACCGCGTAACTCAAACCAATATGCAGTCAT
CATTTGAAGGGAAAACTTAAGATTAAATTTAGTTTAATAATTTAATAAAA
ACTGTACTGATAATGTCTAAAAAGAATATAAATGACCATTTGATATGGAA
GTAGAGGTAAAAAAAAAAAAAAAAAA

LD26105.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG10591.a 1925 CG10591.a 755..1813 1..1059 5295 100 Plus
CG10591-RA 1395 CG10591-RA 225..1283 1..1059 5295 100 Plus
nc_10801.a 275 nc_10801.a 109..275 230..64 835 100 Minus
nc_10801.a 275 nc_10801.a 1..116 632..517 580 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5591112..5592115 1058..55 4960 99.6 Minus
chr3L 24539361 chr3L 5592174..5592230 57..1 285 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5598556..5599560 1059..55 5025 100 Minus
3L 28110227 3L 5599619..5599675 57..1 285 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5591656..5592660 1059..55 5025 100 Minus
3L 28103327 3L 5592719..5592775 57..1 285 100 Minus
Blast to na_te.dros performed on 2019-03-16 02:18:41 has no hits.

LD26105.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:19:41 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5591112..5592114 56..1058 96 <- Minus
chr3L 5592176..5592230 1..55 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:12 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 1..939 19..957 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:22:24 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 1..939 19..957 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:44 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 1..939 19..957 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:09 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 1..939 19..957 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:51 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 1..939 19..957 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:49:05 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 15..1072 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:22:24 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 15..1072 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:44 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 18..1075 1..1058 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:13:10 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 15..1072 1..1058 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:51 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
CG10591-RA 18..1075 1..1058 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:41 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5598557..5599559 56..1058 100 <- Minus
3L 5599621..5599675 1..55 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:41 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5598557..5599559 56..1058 100 <- Minus
3L 5599621..5599675 1..55 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:41 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5598557..5599559 56..1058 100 <- Minus
3L 5599621..5599675 1..55 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:44 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5591657..5592659 56..1058 100 <- Minus
arm_3L 5592721..5592775 1..55 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:56 Download gff for LD26105.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5591657..5592659 56..1058 100 <- Minus
3L 5592721..5592775 1..55 100   Minus

LD26105.hyp Sequence

Translation from 0 to 956

> LD26105.hyp
RNPKYIMSFLGLLAFLVAGLCSTAQASLVKCSCDPGPQGERGPPGPPGPP
GNQNGLSGSGSGYWGYPPTGPYPPNLPFIQGPRGLPGPPGPPGYCFPCPA
PPPLRSFPPPGVPVPPFISTPGGGGFGGASALTTAVGNIIVIPGGPGTGL
AGRAQFFHISPDGQVVQIDRPQNLPSELFDTPVNQGSGAPIPPPQPTSSS
LSGITPPAVQVPPTQPTPGDLGAQQPTILPENMEETVFAVGNRKDFLRGS
SDASDWRRILLLGERPTDGLLKGQSVQQLSPNQLESSVENFQRALVELKE
KYATLIQPRNSNQYAVII*

LD26105.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG10591-PA 312 CG10591-PA 1..312 7..318 1690 100 Plus
CG10625-PJ 752 CG10625-PJ 131..300 36..228 200 32 Plus
CG10625-PI 766 CG10625-PI 131..300 36..228 200 32 Plus
CG10625-PH 1180 CG10625-PH 545..714 36..228 200 32 Plus
CG10625-PD 268 CG10625-PD 134..222 36..122 184 48.3 Plus
CG10625-PJ 752 CG10625-PJ 159..373 35..238 174 31.3 Plus
CG10625-PI 766 CG10625-PI 159..373 35..238 174 31.3 Plus
CG10625-PH 1180 CG10625-PH 573..787 35..238 174 31.3 Plus

LD26105.pep Sequence

Translation from 18 to 956

> LD26105.pep
MSFLGLLAFLVAGLCSTAQASLVKCSCDPGPQGERGPPGPPGPPGNQNGL
SGSGSGYWGYPPTGPYPPNLPFIQGPRGLPGPPGPPGYCFPCPAPPPLRS
FPPPGVPVPPFISTPGGGGFGGASALTTAVGNIIVIPGGPGTGLAGRAQF
FHISPDGQVVQIDRPQNLPSELFDTPVNQGSGAPIPPPQPTSSSLSGITP
PAVQVPPTQPTPGDLGAQQPTILPENMEETVFAVGNRKDFLRGSSDASDW
RRILLLGERPTDGLLKGQSVQQLSPNQLESSVENFQRALVELKEKYATLI
QPRNSNQYAVII*

LD26105.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10454-PA 312 GF10454-PA 1..312 1..312 845 74.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14122-PA 312 GG14122-PA 1..312 1..312 1069 92.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG10591-PA 312 CG10591-PA 1..312 1..312 1690 100 Plus
frm-PJ 752 CG10625-PJ 131..300 30..222 200 32 Plus
frm-PI 766 CG10625-PI 131..300 30..222 200 32 Plus
frm-PH 1180 CG10625-PH 545..714 30..222 200 32 Plus
frm-PD 268 CG10625-PD 134..222 30..116 184 48.3 Plus
frm-PA 268 CG10625-PA 134..222 30..116 184 48.3 Plus
frm-PE 652 CG10625-PE 518..606 30..116 184 48.3 Plus
frm-PB 682 CG10625-PB 548..636 30..116 184 48.3 Plus
frm-PC 682 CG10625-PC 548..636 30..116 184 48.3 Plus
frm-PJ 752 CG10625-PJ 159..373 29..232 174 31.3 Plus
frm-PI 766 CG10625-PI 159..373 29..232 174 31.3 Plus
frm-PH 1180 CG10625-PH 573..787 29..232 174 31.3 Plus
CG5225-PA 594 CG5225-PA 69..256 25..212 174 30.3 Plus
frm-PD 268 CG10625-PD 159..237 29..110 169 51.2 Plus
frm-PA 268 CG10625-PA 159..237 29..110 169 51.2 Plus
frm-PE 652 CG10625-PE 543..621 29..110 169 51.2 Plus
frm-PB 682 CG10625-PB 573..651 29..110 169 51.2 Plus
frm-PC 682 CG10625-PC 573..651 29..110 169 51.2 Plus
frm-PD 268 CG10625-PD 128..222 30..141 168 41.4 Plus
frm-PA 268 CG10625-PA 128..222 30..141 168 41.4 Plus
frm-PE 652 CG10625-PE 512..606 30..141 168 41.4 Plus
frm-PB 682 CG10625-PB 542..636 30..141 168 41.4 Plus
frm-PC 682 CG10625-PC 542..636 30..141 168 41.4 Plus
CG10555-PB 926 CG10555-PB 557..789 29..229 160 30.7 Plus
CG10555-PA 926 CG10555-PA 557..789 29..229 160 30.7 Plus
frm-PD 268 CG10625-PD 83..263 32..213 157 35.1 Plus
frm-PA 268 CG10625-PA 83..263 32..213 157 35.1 Plus
frm-PB 682 CG10625-PB 497..677 32..213 157 35.1 Plus
frm-PC 682 CG10625-PC 497..677 32..213 157 35.1 Plus
frm-PE 652 CG10625-PE 466..647 34..213 155 35.1 Plus
frm-PJ 752 CG10625-PJ 83..260 32..220 154 33.8 Plus
frm-PI 766 CG10625-PI 83..260 32..220 154 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11996-PA 210 GL11996-PA 27..205 6..179 210 63.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10421-PA 319 GA10421-PA 6..319 6..312 592 64.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13908-PA 312 GM13908-PA 1..312 1..312 1172 95.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13185-PA 312 GD13185-PA 1..312 1..312 1167 95.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:49:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16878-PA 328 GK16878-PA 1..328 3..312 515 48 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20546-PA 312 GE20546-PA 1..312 1..312 1153 90.1 Plus