Associations are from manual ordering of a clone or by a periodic analysis.
Clone Sequence Records
LD26105.complete Sequence
1076 bp (1076 high quality bases) assembled on 2002-06-12
GenBank Submission: AY122168
> LD26105.complete
AGAAATCCGAAGTACATCATGAGTTTTTTGGGACTCTTGGCTTTTCTGGT
TGCTGGTCTTTGCTCCACCGCCCAGGCTTCGTTGGTGAAATGCTCTTGTG
ATCCTGGTCCACAGGGGGAACGAGGACCTCCAGGTCCGCCTGGACCTCCT
GGCAATCAGAACGGTCTCTCTGGCAGTGGTTCTGGCTACTGGGGCTATCC
ACCCACAGGTCCTTACCCCCCAAATCTGCCTTTCATCCAGGGGCCTAGAG
GCTTACCAGGACCGCCTGGTCCTCCTGGATATTGTTTCCCATGCCCAGCT
CCTCCACCTTTGAGATCCTTTCCGCCACCGGGAGTTCCAGTCCCTCCTTT
CATTTCCACCCCAGGTGGTGGCGGATTTGGTGGAGCCTCTGCATTGACCA
CCGCTGTGGGCAACATTATAGTGATTCCAGGAGGACCAGGAACGGGATTA
GCTGGTCGCGCTCAGTTCTTCCACATTTCACCCGATGGCCAGGTGGTGCA
GATCGATCGACCGCAGAATCTGCCCAGTGAACTGTTCGATACACCGGTGA
ACCAAGGTTCCGGTGCTCCCATTCCTCCACCGCAACCCACATCGTCATCT
CTCTCGGGGATCACACCACCAGCAGTCCAAGTGCCACCAACTCAACCCAC
GCCCGGCGATCTGGGAGCCCAGCAGCCCACAATTTTGCCCGAGAATATGG
AGGAAACTGTGTTTGCGGTTGGCAATCGCAAGGACTTCCTGCGAGGTAGC
TCCGATGCCAGCGATTGGAGAAGGATTCTCCTCCTGGGAGAGCGACCCAC
CGATGGTCTACTCAAGGGCCAGTCCGTCCAGCAGCTCAGTCCCAACCAGC
TCGAGAGCAGCGTGGAGAACTTCCAGAGGGCTTTGGTCGAACTGAAGGAG
AAGTATGCCACGCTCATCCAACCGCGTAACTCAAACCAATATGCAGTCAT
CATTTGAAGGGAAAACTTAAGATTAAATTTAGTTTAATAATTTAATAAAA
ACTGTACTGATAATGTCTAAAAAGAATATAAATGACCATTTGATATGGAA
GTAGAGGTAAAAAAAAAAAAAAAAAA
LD26105.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:47:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10591.a | 1925 | CG10591.a | 755..1813 | 1..1059 | 5295 | 100 | Plus |
CG10591-RA | 1395 | CG10591-RA | 225..1283 | 1..1059 | 5295 | 100 | Plus |
nc_10801.a | 275 | nc_10801.a | 109..275 | 230..64 | 835 | 100 | Minus |
nc_10801.a | 275 | nc_10801.a | 1..116 | 632..517 | 580 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:18:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 5591112..5592115 | 1058..55 | 4960 | 99.6 | Minus |
chr3L | 24539361 | chr3L | 5592174..5592230 | 57..1 | 285 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:18:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 5598556..5599560 | 1059..55 | 5025 | 100 | Minus |
3L | 28110227 | 3L | 5599619..5599675 | 57..1 | 285 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:20:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 5591656..5592660 | 1059..55 | 5025 | 100 | Minus |
3L | 28103327 | 3L | 5592719..5592775 | 57..1 | 285 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 02:18:41 has no hits.
LD26105.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:19:41 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 5591112..5592114 | 56..1058 | 96 | <- | Minus |
chr3L | 5592176..5592230 | 1..55 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:12 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 1..939 | 19..957 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:22:24 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 1..939 | 19..957 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:35:44 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 1..939 | 19..957 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:13:09 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 1..939 | 19..957 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:51 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 1..939 | 19..957 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:49:05 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 15..1072 | 1..1058 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:22:24 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 15..1072 | 1..1058 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:35:44 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 18..1075 | 1..1058 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:13:10 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 15..1072 | 1..1058 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:51 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG10591-RA | 18..1075 | 1..1058 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:41 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 5598557..5599559 | 56..1058 | 100 | <- | Minus |
3L | 5599621..5599675 | 1..55 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:41 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 5598557..5599559 | 56..1058 | 100 | <- | Minus |
3L | 5599621..5599675 | 1..55 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:19:41 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 5598557..5599559 | 56..1058 | 100 | <- | Minus |
3L | 5599621..5599675 | 1..55 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:35:44 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 5591657..5592659 | 56..1058 | 100 | <- | Minus |
arm_3L | 5592721..5592775 | 1..55 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:45:56 Download gff for
LD26105.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 5591657..5592659 | 56..1058 | 100 | <- | Minus |
3L | 5592721..5592775 | 1..55 | 100 | | Minus |
LD26105.hyp Sequence
Translation from 0 to 956
> LD26105.hyp
RNPKYIMSFLGLLAFLVAGLCSTAQASLVKCSCDPGPQGERGPPGPPGPP
GNQNGLSGSGSGYWGYPPTGPYPPNLPFIQGPRGLPGPPGPPGYCFPCPA
PPPLRSFPPPGVPVPPFISTPGGGGFGGASALTTAVGNIIVIPGGPGTGL
AGRAQFFHISPDGQVVQIDRPQNLPSELFDTPVNQGSGAPIPPPQPTSSS
LSGITPPAVQVPPTQPTPGDLGAQQPTILPENMEETVFAVGNRKDFLRGS
SDASDWRRILLLGERPTDGLLKGQSVQQLSPNQLESSVENFQRALVELKE
KYATLIQPRNSNQYAVII*
LD26105.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:01:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10591-PA | 312 | CG10591-PA | 1..312 | 7..318 | 1690 | 100 | Plus |
CG10625-PJ | 752 | CG10625-PJ | 131..300 | 36..228 | 200 | 32 | Plus |
CG10625-PI | 766 | CG10625-PI | 131..300 | 36..228 | 200 | 32 | Plus |
CG10625-PH | 1180 | CG10625-PH | 545..714 | 36..228 | 200 | 32 | Plus |
CG10625-PD | 268 | CG10625-PD | 134..222 | 36..122 | 184 | 48.3 | Plus |
CG10625-PJ | 752 | CG10625-PJ | 159..373 | 35..238 | 174 | 31.3 | Plus |
CG10625-PI | 766 | CG10625-PI | 159..373 | 35..238 | 174 | 31.3 | Plus |
CG10625-PH | 1180 | CG10625-PH | 573..787 | 35..238 | 174 | 31.3 | Plus |
LD26105.pep Sequence
Translation from 18 to 956
> LD26105.pep
MSFLGLLAFLVAGLCSTAQASLVKCSCDPGPQGERGPPGPPGPPGNQNGL
SGSGSGYWGYPPTGPYPPNLPFIQGPRGLPGPPGPPGYCFPCPAPPPLRS
FPPPGVPVPPFISTPGGGGFGGASALTTAVGNIIVIPGGPGTGLAGRAQF
FHISPDGQVVQIDRPQNLPSELFDTPVNQGSGAPIPPPQPTSSSLSGITP
PAVQVPPTQPTPGDLGAQQPTILPENMEETVFAVGNRKDFLRGSSDASDW
RRILLLGERPTDGLLKGQSVQQLSPNQLESSVENFQRALVELKEKYATLI
QPRNSNQYAVII*
LD26105.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:49:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10454-PA | 312 | GF10454-PA | 1..312 | 1..312 | 845 | 74.3 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:49:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG14122-PA | 312 | GG14122-PA | 1..312 | 1..312 | 1069 | 92.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG10591-PA | 312 | CG10591-PA | 1..312 | 1..312 | 1690 | 100 | Plus |
frm-PJ | 752 | CG10625-PJ | 131..300 | 30..222 | 200 | 32 | Plus |
frm-PI | 766 | CG10625-PI | 131..300 | 30..222 | 200 | 32 | Plus |
frm-PH | 1180 | CG10625-PH | 545..714 | 30..222 | 200 | 32 | Plus |
frm-PD | 268 | CG10625-PD | 134..222 | 30..116 | 184 | 48.3 | Plus |
frm-PA | 268 | CG10625-PA | 134..222 | 30..116 | 184 | 48.3 | Plus |
frm-PE | 652 | CG10625-PE | 518..606 | 30..116 | 184 | 48.3 | Plus |
frm-PB | 682 | CG10625-PB | 548..636 | 30..116 | 184 | 48.3 | Plus |
frm-PC | 682 | CG10625-PC | 548..636 | 30..116 | 184 | 48.3 | Plus |
frm-PJ | 752 | CG10625-PJ | 159..373 | 29..232 | 174 | 31.3 | Plus |
frm-PI | 766 | CG10625-PI | 159..373 | 29..232 | 174 | 31.3 | Plus |
frm-PH | 1180 | CG10625-PH | 573..787 | 29..232 | 174 | 31.3 | Plus |
CG5225-PA | 594 | CG5225-PA | 69..256 | 25..212 | 174 | 30.3 | Plus |
frm-PD | 268 | CG10625-PD | 159..237 | 29..110 | 169 | 51.2 | Plus |
frm-PA | 268 | CG10625-PA | 159..237 | 29..110 | 169 | 51.2 | Plus |
frm-PE | 652 | CG10625-PE | 543..621 | 29..110 | 169 | 51.2 | Plus |
frm-PB | 682 | CG10625-PB | 573..651 | 29..110 | 169 | 51.2 | Plus |
frm-PC | 682 | CG10625-PC | 573..651 | 29..110 | 169 | 51.2 | Plus |
frm-PD | 268 | CG10625-PD | 128..222 | 30..141 | 168 | 41.4 | Plus |
frm-PA | 268 | CG10625-PA | 128..222 | 30..141 | 168 | 41.4 | Plus |
frm-PE | 652 | CG10625-PE | 512..606 | 30..141 | 168 | 41.4 | Plus |
frm-PB | 682 | CG10625-PB | 542..636 | 30..141 | 168 | 41.4 | Plus |
frm-PC | 682 | CG10625-PC | 542..636 | 30..141 | 168 | 41.4 | Plus |
CG10555-PB | 926 | CG10555-PB | 557..789 | 29..229 | 160 | 30.7 | Plus |
CG10555-PA | 926 | CG10555-PA | 557..789 | 29..229 | 160 | 30.7 | Plus |
frm-PD | 268 | CG10625-PD | 83..263 | 32..213 | 157 | 35.1 | Plus |
frm-PA | 268 | CG10625-PA | 83..263 | 32..213 | 157 | 35.1 | Plus |
frm-PB | 682 | CG10625-PB | 497..677 | 32..213 | 157 | 35.1 | Plus |
frm-PC | 682 | CG10625-PC | 497..677 | 32..213 | 157 | 35.1 | Plus |
frm-PE | 652 | CG10625-PE | 466..647 | 34..213 | 155 | 35.1 | Plus |
frm-PJ | 752 | CG10625-PJ | 83..260 | 32..220 | 154 | 33.8 | Plus |
frm-PI | 766 | CG10625-PI | 83..260 | 32..220 | 154 | 33.8 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:49:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL11996-PA | 210 | GL11996-PA | 27..205 | 6..179 | 210 | 63.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:49:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA10421-PA | 319 | GA10421-PA | 6..319 | 6..312 | 592 | 64.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:49:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM13908-PA | 312 | GM13908-PA | 1..312 | 1..312 | 1172 | 95.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:49:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13185-PA | 312 | GD13185-PA | 1..312 | 1..312 | 1167 | 95.8 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:49:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK16878-PA | 328 | GK16878-PA | 1..328 | 3..312 | 515 | 48 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:49:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE20546-PA | 312 | GE20546-PA | 1..312 | 1..312 | 1153 | 90.1 | Plus |