Clone LD26157 Report

Search the DGRC for LD26157

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:261
Well:57
Vector:pOT2
Associated Gene/TranscriptTfIIFalpha-RA
Protein status:LD26157.pep: gold
Preliminary Size:2035
Sequenced Size:1930

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10281 2001-01-01 Release 2 assignment
CG10281 2001-07-04 Blastp of sequenced clone
CG10281 2003-01-01 Sim4 clustering to Release 3
TfIIFalpha 2008-04-29 Release 5.5 accounting
TfIIFalpha 2008-08-15 Release 5.9 accounting
TfIIFalpha 2008-12-18 5.12 accounting

Clone Sequence Records

LD26157.complete Sequence

1930 bp (1930 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051733

> LD26157.complete
AGAAAATCCAACTTTTCTGCCCGCGCCGCGAATTGTAAGAGTTTGGGGAA
AAGTATAAAATATCCAGATAGAAGCAACATATGATTAGCAAACATTAAGC
CATGTCGAGCGCGTCAAAGTCGACGCCGAGCGCTGCCAGCGGGAGCTCCA
CGTCCGCAGCTGCCGCCGCCGCAGCCTCTGTCGCCTCAGGATCCGCCTCG
TCATCCGCCAACGTGCAGGAGTTCAAGATCCGCGTGCCCAAGATGCCCAA
GAAGCACCATGTGATGCGGTTCAACGCCACGCTCAATGTGGATTTCGCGC
AGTGGAGAAATGTGAAACTGGAGCGGGAAAACAACATGAAGGAGTTCCGG
GGCATGGAGGAGGATCAGCCCAAGTTTGGTGCTGGATCGGAGTACAACCG
GGATCAGCGCGAGGAGGCGCGCCGCAAGAAGTTTGGCATTATAGCGAGAA
AGTACCGTCCAGAGGCACAGCCATGGATCCTTAAAGTGGGTGGCAAGACT
GGAAAGAAGTTCAAAGGCATCCGCGAGGGCGGCGTAGGCGAGAATGCAGC
TTTCTATGTGTTCACCCATGCACCAGACGGCGCCATTGAGGCATACCCCT
TGACCGAGTGGTACAACTTCCAGCCTATTCAGCGCTACAAATCGCTGTCG
GCGGAGGAGGCCGAACAGGAATTTGGTCGGCGCAAAAAGGTGATGAACTA
CTTCTCCCTTATGTTGCGAAAGCGTCTGCGCGGCGATGAGGAAGAGGAGC
AGGATCCGGAGGAGGCTAAGCTAATTAAGGCAGCCACCAAAAAATCCAAG
GAGCTCAAGATCACTGACATGGATGAATGGATTGATTCCGAGGATGAGTC
GGATTCGGAGGACGAGGAGGATAAAAAGAAGAAGGAGCAGGAAGACAGCG
ACGATGGCAAGGCCAAGGGAAAGGGCAAGAAGGGCGCAGACAAGAAAAAG
AAAAAGAGGGATGTTGATGACGAGGCCTTCGAGGAGTCGGACGATGGTGA
CGAGGAGGGCAGAGAAATGGACTACGACACCAGCTCCAGTGAAGACGAAC
CAGATCCAGAGGCAAAGGTGGACAAGGACATGAAAGGCGTGGCCGAGGAA
GATGCGCTCCGCAAGCTGCTTACCTCCGATGAAGAGGAGGATGATGAGAA
GAAGTCTGATGAGTCGGACAAGGAGGATGCCGACGGCGAGAAAAAAAAGA
AGGATAAGGGCAAGGACGAGGTATCCAAGGACAAAAAGAAGAAGAAACCC
ACAAAGGACGACAAGAAGGGCAAGTCGAATGGCAGCGGTGACTCGTCCAC
AGACTTCAGCTCTGACAGCACAGACTCCGAGGACGACCTTAGCAACGGAC
CGCCCAAGAAGAAGGTCGTCGTCAAGGACAAAGACAAGGAAAAGGAAAAG
GAGAAAGAGAGCGCTGCGAGCAGCAAGGTCATCGCCAGCAGCAGCAATGC
CAATAAATCTCGCTCGGCCACTCCAACGCTCTCGACGGATGCCAGCAAGC
GCAAGATGAACAGCTTACCCAGCGATCTCACCGCTTCGGACACAAGCAAC
AGTCCCACCAGCACGCCAGCAAAGAGGCCTAAGAACGAGATTAGCACATC
GCTGCCCACTTCCTTCTCTGGCGGCAAAGTAGAGGACTACGGCATCACCG
AGGAGGCGGTGCGTCGGTATCTTAAGCGAAAGCCCCTGACCGCCACCGAG
TTGCTCACCAAGTTCAAGAACAAGAAGACGCCTGTCTCCAGCGACCGTTT
GGTCGAGACCATGACGAAAATCCTGAAGAAGATCAATCCCGTCAAGCACA
CCATCCAGGGGAAAATGTATCTCTGGATCAAGTAGCCCGCAGTCATGTGA
TTTTAATGTTTCATAACTCAAATGCATTATTGTTCAACACAAAATATAAA
CGCACCACTGAAAAAAAAAAAAAAAAAAAA

LD26157.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:32:10
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFalpha-RA 2159 TfIIFalpha-RA 158..2071 1..1914 9570 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2206363..2207283 125..1045 4590 99.9 Plus
chr3R 27901430 chr3R 2207360..2207948 1046..1634 2945 100 Plus
chr3R 27901430 chr3R 2208006..2208282 1634..1910 1385 100 Plus
chr3R 27901430 chr3R 2206173..2206297 1..125 625 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6380685..6381605 125..1045 4605 100 Plus
3R 32079331 3R 6381682..6382270 1046..1634 2945 100 Plus
3R 32079331 3R 6382328..6382608 1634..1914 1405 100 Plus
3R 32079331 3R 6380495..6380619 1..125 625 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6121516..6122436 125..1045 4605 100 Plus
3R 31820162 3R 6122513..6123101 1046..1634 2945 100 Plus
3R 31820162 3R 6123159..6123439 1634..1914 1405 100 Plus
3R 31820162 3R 6121326..6121450 1..125 625 100 Plus
Blast to na_te.dros performed 2019-03-16 20:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2538 1250..1471 129 54.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6738..6886 1419..1572 126 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6759..6904 1419..1575 120 57.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1512..1568 1391..1447 114 66.7 Plus

LD26157.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:27:21 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2206173..2206297 1..125 100 -> Plus
chr3R 2206364..2207283 126..1045 99 -> Plus
chr3R 2207360..2207947 1046..1633 100 -> Plus
chr3R 2208006..2208282 1634..1910 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:14 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 1..1734 102..1835 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:21:06 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 1..1734 102..1835 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:32 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 1..1734 102..1835 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:52:59 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 1..1734 102..1835 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:02:29 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 1..1734 102..1835 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:17:45 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 37..1946 1..1910 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:21:05 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 37..1946 1..1910 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:32 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 29..1938 1..1910 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:53:01 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 37..1946 1..1910 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:02:29 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
TfIIFalpha-RA 29..1938 1..1910 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:21 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6382328..6382604 1634..1910 100   Plus
3R 6380495..6380619 1..125 100 -> Plus
3R 6380686..6381605 126..1045 100 -> Plus
3R 6381682..6382269 1046..1633 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:21 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6382328..6382604 1634..1910 100   Plus
3R 6380495..6380619 1..125 100 -> Plus
3R 6380686..6381605 126..1045 100 -> Plus
3R 6381682..6382269 1046..1633 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:21 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6382328..6382604 1634..1910 100   Plus
3R 6380495..6380619 1..125 100 -> Plus
3R 6380686..6381605 126..1045 100 -> Plus
3R 6381682..6382269 1046..1633 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:32 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2206217..2206341 1..125 100 -> Plus
arm_3R 2206408..2207327 126..1045 100 -> Plus
arm_3R 2207404..2207991 1046..1633 100 -> Plus
arm_3R 2208050..2208326 1634..1910 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:31:17 Download gff for LD26157.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6121326..6121450 1..125 100 -> Plus
3R 6121517..6122436 126..1045 100 -> Plus
3R 6122513..6123100 1046..1633 100 -> Plus
3R 6123159..6123435 1634..1910 100   Plus

LD26157.pep Sequence

Translation from 101 to 1834

> LD26157.pep
MSSASKSTPSAASGSSTSAAAAAAASVASGSASSSANVQEFKIRVPKMPK
KHHVMRFNATLNVDFAQWRNVKLERENNMKEFRGMEEDQPKFGAGSEYNR
DQREEARRKKFGIIARKYRPEAQPWILKVGGKTGKKFKGIREGGVGENAA
FYVFTHAPDGAIEAYPLTEWYNFQPIQRYKSLSAEEAEQEFGRRKKVMNY
FSLMLRKRLRGDEEEEQDPEEAKLIKAATKKSKELKITDMDEWIDSEDES
DSEDEEDKKKKEQEDSDDGKAKGKGKKGADKKKKKRDVDDEAFEESDDGD
EEGREMDYDTSSSEDEPDPEAKVDKDMKGVAEEDALRKLLTSDEEEDDEK
KSDESDKEDADGEKKKKDKGKDEVSKDKKKKKPTKDDKKGKSNGSGDSST
DFSSDSTDSEDDLSNGPPKKKVVVKDKDKEKEKEKESAASSKVIASSSNA
NKSRSATPTLSTDASKRKMNSLPSDLTASDTSNSPTSTPAKRPKNEISTS
LPTSFSGGKVEDYGITEEAVRRYLKRKPLTATELLTKFKNKKTPVSSDRL
VETMTKILKKINPVKHTIQGKMYLWIK*

LD26157.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18359-PA 577 GF18359-PA 1..577 1..577 1974 88.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13412-PA 581 GG13412-PA 1..581 1..577 2915 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:40:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19532-PA 570 GH19532-PA 34..570 36..577 1756 84.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:14:59
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFalpha-PA 577 CG10281-PA 1..577 1..577 2946 100 Plus
CG8108-PA 919 CG8108-PA 246..463 188..410 220 29.7 Plus
CG8108-PB 919 CG8108-PB 246..463 188..410 220 29.7 Plus
l(2)01289-PG 1191 CG9432-PG 771..980 212..417 220 27.5 Plus
l(2)01289-PM 1193 CG9432-PM 771..980 212..417 220 27.5 Plus
l(2)01289-PG 1191 CG9432-PG 703..994 185..472 208 23.3 Plus
l(2)01289-PM 1193 CG9432-PM 703..994 185..472 208 23.3 Plus
Sh3beta-PE 485 CG8582-PE 102..404 223..517 191 26.5 Plus
l(2)01289-PG 1191 CG9432-PG 697..904 208..436 187 25.6 Plus
l(2)01289-PM 1193 CG9432-PM 697..904 208..436 187 25.6 Plus
rudhira-PE 2075 CG43154-PE 1372..1701 180..512 186 25.1 Plus
rudhira-PC 2075 CG43154-PC 1372..1701 180..512 186 25.1 Plus
Sh3beta-PE 485 CG8582-PE 119..462 207..556 184 23.2 Plus
CG14692-PE 2851 CG14692-PE 967..1466 12..509 180 20.8 Plus
spen-PH 5458 CG18497-PH 1756..2062 215..501 180 20.1 Plus
spen-PC 5476 CG18497-PC 1774..2080 215..501 180 20.1 Plus
spen-PG 5487 CG18497-PG 1758..2064 215..501 180 20.1 Plus
spen-PE 5505 CG18497-PE 1776..2082 215..501 180 20.1 Plus
spen-PD 5505 CG18497-PD 1776..2082 215..501 180 20.1 Plus
spen-PF 5510 CG18497-PF 1781..2087 215..501 180 20.1 Plus
spen-PB 5533 CG18497-PB 1831..2137 215..501 180 20.1 Plus
spen-PA 5560 CG18497-PA 1831..2137 215..501 180 20.1 Plus
CG12877-PC 991 CG12877-PC 18..341 146..491 177 20.6 Plus
Asph-PK 556 CG8421-PK 121..334 212..436 176 22.4 Plus
Ssrp-PA 723 CG4817-PA 441..713 211..451 176 27.1 Plus
CG13185-PD 5526 CG13185-PD 4644..4969 210..500 175 22 Plus
Sh3beta-PE 485 CG8582-PE 194..472 213..489 174 22.2 Plus
Asph-PG 557 CG8421-PG 121..335 212..436 174 21.8 Plus
Asph-PI 575 CG8421-PI 139..353 212..436 174 21.8 Plus
CG2839-PA 826 CG2839-PA 509..771 185..468 174 22.3 Plus
ncm-PA 1330 CG12750-PA 982..1245 213..467 173 22.8 Plus
Claspin-PB 1465 CG32251-PB 139..500 206..525 173 22.3 Plus
Claspin-PA 1465 CG32251-PA 139..500 206..525 173 22.3 Plus
PPP4R2r-PD 522 CG2890-PD 132..411 211..499 172 21.5 Plus
PPP4R2r-PC 609 CG2890-PC 219..498 211..499 172 21.5 Plus
PPP4R2r-PB 609 CG2890-PB 219..498 211..499 172 21.5 Plus
PPP4R2r-PA 609 CG2890-PA 219..498 211..499 172 21.5 Plus
CG31797-PA 868 CG31797-PA 424..663 208..443 172 23.7 Plus
Asph-PL 991 CG8421-PL 121..333 212..436 172 21.8 Plus
CG2839-PA 826 CG2839-PA 449..710 185..436 171 22.6 Plus
ear-PC 931 CG4913-PC 259..521 245..480 171 27.6 Plus
ear-PA 931 CG4913-PA 259..521 245..480 171 27.6 Plus
ear-PB 945 CG4913-PB 259..521 245..480 171 27.6 Plus
CG11180-PB 603 CG11180-PB 278..598 185..495 170 22.1 Plus
CG2839-PA 826 CG2839-PA 316..567 185..435 169 17.8 Plus
Asph-PB 382 CG8421-PB 117..375 237..476 169 20.1 Plus
Asph-PJ 400 CG8421-PJ 135..393 237..476 169 20.1 Plus
CG11180-PA 726 CG11180-PA 278..589 185..486 169 22.4 Plus
Asph-PA 785 CG8421-PA 117..375 237..476 169 20.1 Plus
Asph-PH 803 CG8421-PH 135..393 237..476 169 20.1 Plus
CG8108-PA 919 CG8108-PA 245..475 217..444 167 26.7 Plus
CG8108-PB 919 CG8108-PB 245..475 217..444 167 26.7 Plus
CG2839-PA 826 CG2839-PA 325..578 177..436 166 18.5 Plus
CG42795-PC 2904 CG42795-PC 1167..1440 213..495 165 22.8 Plus
CG42795-PF 2928 CG42795-PF 1167..1440 213..495 165 22.8 Plus
CG42795-PB 3068 CG42795-PB 1046..1319 213..495 165 22.8 Plus
CG42795-PA 3189 CG3996-PA 1167..1440 213..495 165 22.8 Plus
CG42795-PE 3190 CG42795-PE 1167..1440 213..495 165 22.8 Plus
CG42795-PG 3213 CG42795-PG 1167..1440 213..495 165 22.8 Plus
ncm-PA 1330 CG12750-PA 937..1228 223..496 163 19.7 Plus
Claspin-PB 1465 CG32251-PB 123..432 214..499 163 21 Plus
Claspin-PB 1465 CG32251-PB 279..599 214..548 163 24.5 Plus
Claspin-PA 1465 CG32251-PA 123..432 214..499 163 21 Plus
Claspin-PA 1465 CG32251-PA 279..599 214..548 163 24.5 Plus
CG14692-PE 2851 CG14692-PE 1101..1462 232..572 162 21.6 Plus
CG2839-PA 826 CG2839-PA 284..563 176..468 162 18 Plus
SRm160-PA 954 CG11274-PA 713..904 212..408 162 29.4 Plus
CG31797-PA 868 CG31797-PA 397..648 212..453 161 23 Plus
Nopp140-PF 685 CG7421-PF 93..428 172..491 161 22.5 Plus
Nopp140-PB 686 CG7421-PB 93..428 172..491 161 22.5 Plus
CG2839-PA 826 CG2839-PA 534..796 177..441 158 21 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:40:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23011-PA 573 GI23011-PA 30..337 35..341 1194 88.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:40:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22130-PA 559 GL22130-PA 20..559 2..577 984 45.6 Plus
Dper\GL21747-PA 516 GL21747-PA 1..182 1..184 774 87 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:40:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26384-PA 576 GA26384-PA 33..576 37..577 1998 88.4 Plus
Dpse\GA26384-PB 533 GA26384-PB 1..533 48..577 1934 88.2 Plus
Dpse\GA27386-PA 558 GA27386-PA 20..558 2..577 1022 46.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10893-PA 575 GM10893-PA 1..575 1..577 2911 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19872-PA 577 GD19872-PA 1..577 1..577 2944 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24604-PA 569 GJ24604-PA 31..569 36..577 1815 83.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12178-PA 589 GK12178-PA 30..589 37..577 1932 80 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10218-PA 576 GE10218-PA 1..576 1..577 2873 97.1 Plus

LD26157.hyp Sequence

Translation from 101 to 1834

> LD26157.hyp
MSSASKSTPSAASGSSTSAAAAAAASVASGSASSSANVQEFKIRVPKMPK
KHHVMRFNATLNVDFAQWRNVKLERENNMKEFRGMEEDQPKFGAGSEYNR
DQREEARRKKFGIIARKYRPEAQPWILKVGGKTGKKFKGIREGGVGENAA
FYVFTHAPDGAIEAYPLTEWYNFQPIQRYKSLSAEEAEQEFGRRKKVMNY
FSLMLRKRLRGDEEEEQDPEEAKLIKAATKKSKELKITDMDEWIDSEDES
DSEDEEDKKKKEQEDSDDGKAKGKGKKGADKKKKKRDVDDEAFEESDDGD
EEGREMDYDTSSSEDEPDPEAKVDKDMKGVAEEDALRKLLTSDEEEDDEK
KSDESDKEDADGEKKKKDKGKDEVSKDKKKKKPTKDDKKGKSNGSGDSST
DFSSDSTDSEDDLSNGPPKKKVVVKDKDKEKEKEKESAASSKVIASSSNA
NKSRSATPTLSTDASKRKMNSLPSDLTASDTSNSPTSTPAKRPKNEISTS
LPTSFSGGKVEDYGITEEAVRRYLKRKPLTATELLTKFKNKKTPVSSDRL
VETMTKILKKINPVKHTIQGKMYLWIK*

LD26157.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
TfIIFalpha-PA 577 CG10281-PA 1..577 1..577 2946 100 Plus
CG8108-PA 919 CG8108-PA 246..463 188..410 220 29.7 Plus
CG8108-PB 919 CG8108-PB 246..463 188..410 220 29.7 Plus
l(2)01289-PG 1191 CG9432-PG 771..980 212..417 220 27.5 Plus
l(2)01289-PM 1193 CG9432-PM 771..980 212..417 220 27.5 Plus
l(2)01289-PG 1191 CG9432-PG 703..994 185..472 208 23.3 Plus
l(2)01289-PG 1191 CG9432-PG 697..904 208..436 187 25.6 Plus
CG8108-PA 919 CG8108-PA 245..475 217..444 167 26.7 Plus
CG8108-PB 919 CG8108-PB 245..475 217..444 167 26.7 Plus