Clone LD26182 Report

Gene	Date	Evidence
CG2835	2001-01-01	Release 2 assignment
CG2835	2001-09-19	Blastp of sequenced clone
CG2835	2003-01-01	Sim4 clustering to Release 3
G-salpha60A	2008-04-29	Release 5.5 accounting
G-salpha60A	2008-08-15	Release 5.9 accounting
G-salpha60A	2008-12-18	5.12 accounting

Clone Sequence Records

LD26182.complete Sequence

1654 bp (1654 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058572

> LD26182.complete
CTTCGTTGCATCCCTAGGTTGATACATAAAATAAAAAATATATAAAAACC
TGCTGCAGAGATCCACTGAAGCGCTGAGCCAACGCCAACGGTGGTGCCAC
TGAGATCGGAGATCGGAGATCGCAGACCGGAGACCGACGAGCACACAAGG
GATTGTGGTTTGATCCGAGGAACCCAAGCACTCAGCTATACTGGAGCAGA
ACGGAGAAAGCACAAGGGGTGCCGAGTCGCCCGACGCGAACCAGGAAAAC
CGAGCGACGTGTTGGTGGACCCCGTGGGCTGCGATGGGTTGCTTTGGGTC
GCCCACCTCCAAGCAGTCGGACGTGAACTCGGAGGACTCGAAGAGCCAGA
AGCGCCGGAGCGATGCAATATCTAGACAGTTGCAGAAGGACAAACAGCTC
TACAGGGCCACACACAGGCTGCTCCTCCTGGGGGCGGGCGAGTCCGGCAA
ATCAACCATAGTCAAGCAAATGCGAATATTGCATGTCGACGGATTTTCTG
ACTCGGAAAAGAAACAGAAAATTGATGATATTAAAAAGAATATTCGAGAC
GCTATCTTGACTATTACAGGAGCCATGAGCACACTTAATCCACCTGTAGC
TTTAGAAAAGAAGGAAAATGAACCCAGAGTGGAGTACATTCAGGATTATG
CATCTAGTCCGGACTTTAATTATCCTCCTGAATTTTATGAACATACAGAA
GAACTATGGAAAGACAAGGGCGTTCTTCAAACCTATGAGAGGTCGAATGA
GTATCAATTAATCGATTGTGCGAAATACTTCCTGGACCGAGTGAGCACAA
TCAAGAATCCAAACTACACCCCTAATGAGCAGGATATTCTTCGGTGCCGT
GTTTTGACTTCTGGAATATTTGAAACAAGATTTCAAGTGGACAAAGTAAA
CTTTCACATGTTCGATGTCGGTGGCCAGCGGGACGAGCGTAGGAAATGGA
TTCAGTGTTTCAATGATGTAACTGCTATCATATTCGTAACTGCGTGCTCA
AGTTATAACATGGTTTTGCGGGAAGATCCCACCCAGAACCGACTTCGAGA
ATCTTTGGATTTGTTCAAGAGTATTTGGAACAACAGATGGCTTCGCACGA
TTTCTATTATACTATTTTTAAATAAGCAAGATTTGTTAGCAGAGAAAATT
AAGGCTGGAAAAAGTAAATTGTCGGAATATTTCTCCGAGTTTAACAAATA
CCAAACGCCAATCGACACAGGTGACGCAATAATGGAATCCAATGATGACC
CAGAAGTAATACGAGCAAAATATTTCATACGAGACGAGTTTCTGCGTATA
TCTACCGCTAGCGGAGACGGAAAACACTACTGCTATCCACATTTCACATG
CGCCGTTGACACAGAAAACATTAAACGTGTGTTTAATGATTGCAGAGACA
TTATTCAAAGGATGCACCTTCGTCAATATGAATTGTTATAGGTTATCCCC
ATCGCCGTAATGCAAGTAAATAAAAATATTAATGACTTACTGTTTTAAAT
ATAATTATCAAATGTAATTTGTATTTAAATAGTCCCTTGATTAAAACAAA
AAATTCGCTGCATTTAGATCTGGTATGACCTTTCACAAAACTCAACATTA
AAGAATAATAAATAAACATGTTAATAACAGAAAAAAAAAAAAAAAAAAAA
AAAA

LD26182.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:19:35

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
G-salpha60A.b	1717	G-salpha60A.b	82..1712	1..1631	8155	100	Plus
G-salpha60A.a	1862	G-salpha60A.a	275..1857	49..1631	7915	100	Plus
G-salpha60A-RC	1708	G-salpha60A-RC	82..1292	1..1211	6055	100	Plus
G-salpha60A-RC	1708	G-salpha60A-RC	1293..1703	1221..1631	2055	100	Plus
G-salpha60A.a	1862	G-salpha60A.a	14..61	1..48	240	100	Plus

Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:47:06

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
chr2R	21145070	chr2R	19830292..19830802	49..559	2555	100	Plus
chr2R	21145070	chr2R	19832665..19833001	1294..1630	1685	100	Plus
chr2R	21145070	chr2R	19831963..19832142	907..1086	900	100	Plus
chr2R	21145070	chr2R	19831761..19831889	778..906	645	100	Plus
chr2R	21145070	chr2R	19832199..19832326	1084..1211	640	100	Plus
chr2R	21145070	chr2R	19831022..19831142	657..777	605	100	Plus
chr2R	21145070	chr2R	19830868..19830967	559..658	500	100	Plus
chr2R	21145070	chr2R	19832503..19832585	1212..1294	400	98.8	Plus
chr2R	21145070	chr2R	19828614..19828661	1..48	240	100	Plus

Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:16 has no hits.

Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:47:05

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
2R	25286936	2R	23944230..23944740	49..559	2555	100	Plus
2R	25286936	2R	23946600..23946937	1294..1631	1690	100	Plus
2R	25286936	2R	23945898..23946077	907..1086	900	100	Plus
2R	25286936	2R	23945696..23945824	778..906	645	100	Plus
2R	25286936	2R	23946134..23946261	1084..1211	640	100	Plus
2R	25286936	2R	23944960..23945080	657..777	605	100	Plus
2R	25286936	2R	23944806..23944905	559..658	500	100	Plus
2R	25286936	2R	23946438..23946520	1212..1294	415	100	Plus
2R	25286936	2R	23942554..23942601	1..48	240	100	Plus

Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:42:40

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
2R	25260384	2R	23945429..23945939	49..559	2555	100	Plus
2R	25260384	2R	23947799..23948136	1294..1631	1690	100	Plus
2R	25260384	2R	23947097..23947276	907..1086	900	100	Plus
2R	25260384	2R	23946895..23947023	778..906	645	100	Plus
2R	25260384	2R	23947333..23947460	1084..1211	640	100	Plus
2R	25260384	2R	23946159..23946279	657..777	605	100	Plus
2R	25260384	2R	23946005..23946104	559..658	500	100	Plus
2R	25260384	2R	23947637..23947719	1212..1294	415	100	Plus
2R	25260384	2R	23943753..23943800	1..48	240	100	Plus

Blast to na_te.dros performed on 2019-03-16 10:47:05 has no hits.

LD26182.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:48:19 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
chr2R	19831963..19832142	907..1086	100	->	Plus
chr2R	19832202..19832326	1087..1211	100	->	Plus
chr2R	19832503..19832585	1212..1294	98	->	Plus
chr2R	19832666..19833001	1295..1630	100		Plus
chr2R	19831761..19831889	778..906	100	->	Plus
chr2R	19828614..19828638	1..25	100	==	Plus
chr2R	19830292..19830802	49..559	100	->	Plus
chr2R	19830869..19830965	560..656	100	->	Plus
chr2R	19831022..19831142	657..777	100	->	Plus

Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:15 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
G-salpha60A-RB	1..1158	284..1441	100		Plus

Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:02:41 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
G-salpha60A-RD	1..1158	284..1441	100		Plus

Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:08:30 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Galphas-RB	1..1158	284..1441	100		Plus

Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:33:11 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
G-salpha60A-RB	1..1158	284..1441	100		Plus

Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:18 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Galphas-RB	1..1158	284..1441	100		Plus

Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:51:03 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
G-salpha60A-RB	14..61	1..48	100	->	Plus
G-salpha60A-RB	275..1856	49..1630	100		Plus

Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:02:40 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
G-salpha60A-RD	1..1630	1..1630	100		Plus

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:08:30 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Galphas-RD	17..1646	1..1630	100		Plus

Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:33:12 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
G-salpha60A-RB	14..61	1..48	100	->	Plus
G-salpha60A-RB	275..1856	49..1630	100		Plus

Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:18 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
Galphas-RD	17..1646	1..1630	100		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:19 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
2R	23942554..23942601	1..48	100	->	Plus
2R	23944230..23944740	49..559	100	->	Plus
2R	23944807..23944903	560..656	100	->	Plus
2R	23944960..23945080	657..777	100	->	Plus
2R	23945696..23945824	778..906	100	->	Plus
2R	23945898..23946077	907..1086	100	->	Plus
2R	23946137..23946261	1087..1211	100	->	Plus
2R	23946438..23946520	1212..1294	100	->	Plus
2R	23946601..23946936	1295..1630	100		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:19 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
2R	23942554..23942601	1..48	100	->	Plus
2R	23944230..23944740	49..559	100	->	Plus
2R	23944807..23944903	560..656	100	->	Plus
2R	23944960..23945080	657..777	100	->	Plus
2R	23945696..23945824	778..906	100	->	Plus
2R	23945898..23946077	907..1086	100	->	Plus
2R	23946137..23946261	1087..1211	100	->	Plus
2R	23946438..23946520	1212..1294	100	->	Plus
2R	23946601..23946936	1295..1630	100		Plus

Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:19 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
2R	23942554..23942601	1..48	100	->	Plus
2R	23944230..23944740	49..559	100	->	Plus
2R	23944807..23944903	560..656	100	->	Plus
2R	23944960..23945080	657..777	100	->	Plus
2R	23945696..23945824	778..906	100	->	Plus
2R	23945898..23946077	907..1086	100	->	Plus
2R	23946137..23946261	1087..1211	100	->	Plus
2R	23946438..23946520	1212..1294	100	->	Plus
2R	23946601..23946936	1295..1630	100		Plus

Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:08:30 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
arm_2R	19833660..19833784	1087..1211	100	->	Plus
arm_2R	19833961..19834043	1212..1294	100	->	Plus
arm_2R	19830077..19830124	1..48	100	->	Plus
arm_2R	19831753..19832263	49..559	100	->	Plus
arm_2R	19832330..19832426	560..656	100	->	Plus
arm_2R	19832483..19832603	657..777	100	->	Plus
arm_2R	19833219..19833347	778..906	100	->	Plus
arm_2R	19833421..19833600	907..1086	100	->	Plus
arm_2R	19834124..19834459	1295..1630	100		Plus

Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:09:59 Download gff for LD26182.complete

Subject	Subject Range	Query Range	Percent	Splice	Strand
2R	23946177..23946297	657..777	100	->	Plus
2R	23946913..23947041	778..906	100	->	Plus
2R	23947115..23947294	907..1086	100	->	Plus
2R	23947354..23947478	1087..1211	100	->	Plus
2R	23947655..23947737	1212..1294	100	->	Plus
2R	23945447..23945957	49..559	100	->	Plus
2R	23946024..23946120	560..656	100	->	Plus
2R	23947818..23948153	1295..1630	100		Plus
2R	23943771..23943818	1..48	100	->	Plus

LD26182.hyp Sequence

Translation from 283 to 1440

> LD26182.hyp
MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLG
AGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMST
LNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQT
YERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRF
QVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPT
QNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYF
SEFNKYQTPIDTGDAIMESNDDPEVIRAKYFIRDEFLRISTASGDGKHYC
YPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYELL*

LD26182.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:41

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Galphas-PD	385	CG2835-PD	1..385	1..385	2024	100	Plus
Galphas-PB	385	CG2835-PB	1..385	1..385	2024	100	Plus
Galphas-PE	382	CG2835-PE	1..382	1..385	1989	99	Plus
Galphas-PA	382	CG2835-PA	1..382	1..385	1989	99	Plus
Galphas-PC	382	CG2835-PC	1..382	1..385	1989	99	Plus

LD26182.pep Sequence

Translation from 283 to 1440

> LD26182.pep
MGCFGSPTSKQSDVNSEDSKSQKRRSDAISRQLQKDKQLYRATHRLLLLG
AGESGKSTIVKQMRILHVDGFSDSEKKQKIDDIKKNIRDAILTITGAMST
LNPPVALEKKENEPRVEYIQDYASSPDFNYPPEFYEHTEELWKDKGVLQT
YERSNEYQLIDCAKYFLDRVSTIKNPNYTPNEQDILRCRVLTSGIFETRF
QVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIFVTACSSYNMVLREDPT
QNRLRESLDLFKSIWNNRWLRTISIILFLNKQDLLAEKIKAGKSKLSEYF
SEFNKYQTPIDTGDAIMESNDDPEVIRAKYFIRDEFLRISTASGDGKHYC
YPHFTCAVDTENIKRVFNDCRDIIQRMHLRQYELL*

LD26182.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:06:26

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dana\GF12878-PA	382	GF12878-PA	1..382	1..385	2021	97.9	Plus
Dana\GF10510-PA	400	GF10510-PA	8..389	3..374	681	38.5	Plus
Dana\GF10879-PA	355	GF10879-PA	1..355	1..385	664	41	Plus
Dana\GF13765-PA	354	GF13765-PA	19..349	29..380	658	43.2	Plus
Dana\GF13398-PA	432	GF13398-PA	6..431	16..384	635	37	Plus

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:06:26

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dere\GG22906-PA	385	GG22906-PA	1..385	1..385	2076	100	Plus
Dere\GG24169-PA	354	GG24169-PA	1..349	1..380	674	41.6	Plus
Dere\GG15011-PA	355	GG15011-PA	1..355	1..385	660	41	Plus
Dere\GG15859-PA	399	GG15859-PA	46..388	42..374	658	39.9	Plus
Dere\GG20320-PA	432	GG20320-PA	6..431	16..384	635	37	Plus

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:06:27

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dgri\GH21696-PA	382	GH21696-PA	1..382	1..385	2025	97.9	Plus
Dgri\GH21190-PA	353	GH21190-PA	6..353	16..385	695	41.4	Plus
Dgri\GH16099-PA	355	GH16099-PA	1..355	1..385	667	41.6	Plus
Dgri\GH21191-PA	352	GH21191-PA	6..351	16..384	660	41.5	Plus
Dgri\GH21256-PA	354	GH21256-PA	19..349	29..380	655	42.9	Plus

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:45

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Galphas-PD	385	CG2835-PD	1..385	1..385	2024	100	Plus
Galphas-PB	385	CG2835-PB	1..385	1..385	2024	100	Plus
Galphas-PE	382	CG2835-PE	1..382	1..385	1989	99	Plus
Galphas-PA	382	CG2835-PA	1..382	1..385	1989	99	Plus
Galphas-PC	382	CG2835-PC	1..382	1..385	1989	99	Plus
Galphaq-PK	353	CG17759-PK	6..353	16..385	681	41.4	Plus
Galphaq-PE	353	CG17759-PE	6..353	16..385	681	41.4	Plus
Galphaq-PC	353	CG17759-PC	6..353	16..385	681	41.4	Plus
Galphaq-PG	353	CG17759-PG	6..353	16..385	681	41.4	Plus
Galphaq-PA	353	CG17759-PA	6..353	16..385	681	41.4	Plus
Galphaq-PD	353	CG17759-PD	6..352	16..384	671	41.2	Plus
Galphao-PI	354	CG2204-PI	6..349	16..380	661	42.7	Plus
Galphao-PA	354	CG2204-PA	6..349	16..380	661	42.7	Plus
Galphao-PC	354	CG2204-PC	6..349	16..380	661	42.7	Plus
Galphao-PH	354	CG2204-PH	6..349	16..380	659	42.5	Plus
Galphao-PG	354	CG2204-PG	6..349	16..380	659	42.5	Plus
Galphao-PF	354	CG2204-PF	6..349	16..380	659	42.5	Plus
Galphao-PE	354	CG2204-PE	6..349	16..380	659	42.5	Plus
Galphao-PD	354	CG2204-PD	6..349	16..380	659	42.5	Plus
Galphao-PB	354	CG2204-PB	6..349	16..380	659	42.5	Plus
Galphaf-PA	399	CG12232-PA	47..388	43..374	651	40	Plus
Galphai-PA	355	CG10060-PA	5..354	14..384	633	41	Plus
Galphaq-PJ	396	CG17759-PJ	6..395	16..384	627	38.2	Plus
CG17760-PB	353	CG17760-PB	6..353	16..385	586	37	Plus
CG30054-PE	353	CG30054-PE	5..352	15..384	566	38.1	Plus
cta-PB	457	CG17678-PB	104..451	15..379	554	35	Plus
cta-PA	457	CG17678-PA	104..451	15..379	554	35	Plus
CG30054-PF	325	CG30054-PF	1..324	39..384	523	38.1	Plus
Galphao-PJ	127	CG2204-PJ	2..122	239..380	212	41.5	Plus

Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:06:27

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dmoj\GI18851-PA	382	GI18851-PA	1..382	1..385	2032	98.4	Plus
Dmoj\GI20476-PA	353	GI20476-PA	6..353	16..385	692	41.4	Plus
Dmoj\GI20478-PA	353	GI20478-PA	6..352	16..384	677	43	Plus
Dmoj\GI12363-PA	355	GI12363-PA	1..355	1..385	666	41	Plus
Dmoj\GI19334-PA	354	GI19334-PA	1..349	1..380	665	41.1	Plus

Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:06:28

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dper\GL11181-PA	382	GL11181-PA	1..382	1..385	2035	98.4	Plus
Dper\GL17293-PA	354	GL17293-PA	1..349	1..380	668	41.3	Plus
Dper\GL20009-PA	432	GL20009-PA	6..431	16..384	644	37.2	Plus
Dper\GL13228-PA	372	GL13228-PA	12..361	7..374	551	34.5	Plus
Dper\GL21168-PA	414	GL21168-PA	101..387	22..304	491	37.2	Plus

Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:06:29

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dpse\GA15477-PA	382	GA15477-PA	1..382	1..385	2035	98.4	Plus
Dpse\GA14650-PB	353	GA14650-PB	6..353	16..385	695	41.6	Plus
Dpse\GA14650-PD	353	GA14650-PD	6..352	16..384	689	42.5	Plus
Dpse\GA15300-PA	354	GA15300-PA	1..349	1..380	668	41.3	Plus
Dpse\GA10039-PA	355	GA10039-PA	1..355	1..385	666	40.3	Plus

Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:06:29

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsec\GM16066-PA	385	GM16066-PA	1..385	1..385	2076	100	Plus
Dsec\GM21219-PA	354	GM21219-PA	1..349	1..380	673	41.3	Plus
Dsec\GM24377-PA	399	GM24377-PA	46..399	42..385	661	39.2	Plus
Dsec\GM13800-PA	355	GM13800-PA	1..355	1..385	660	40.8	Plus
Dsec\GM21408-PA	432	GM21408-PA	6..431	16..384	634	37	Plus

Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:06:30

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dsim\GD11812-PA	385	GD11812-PA	1..385	1..385	2076	100	Plus
Dsim\GD10742-PA	354	GD10742-PA	1..349	1..380	674	41.6	Plus
Dsim\GD13099-PA	355	GD13099-PA	1..355	1..385	661	40.8	Plus
Dsim\GD12450-PA	399	GD12450-PA	46..388	42..374	645	39.3	Plus
Dsim\GD10904-PA	432	GD10904-PA	6..431	16..384	634	37	Plus

Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:06:30

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dvir\GJ21886-PA	382	GJ21886-PA	1..382	1..385	2032	98.4	Plus
Dvir\GJ22327-PA	353	GJ22327-PA	6..353	16..385	691	41.4	Plus
Dvir\GJ22328-PA	353	GJ22328-PA	6..352	16..384	675	43.2	Plus
Dvir\GJ12256-PA	355	GJ12256-PA	1..355	1..385	666	41	Plus
Dvir\GJ22212-PA	354	GJ22212-PA	1..349	1..380	665	41.1	Plus

Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:06:31

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dwil\GK15719-PA	383	GK15719-PA	1..383	1..385	2019	97.9	Plus
Dwil\GK25662-PA	396	GK25662-PA	46..385	45..374	676	41	Plus
Dwil\GK17195-PA	355	GK17195-PA	1..355	1..385	662	40.8	Plus
Dwil\GK17798-PA	354	GK17798-PA	19..349	29..380	658	43.2	Plus
Dwil\GK23154-PA	432	GK23154-PA	6..431	16..384	636	37	Plus

Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:06:31

Subject	Length	Description	Subject Range	Query Range	Score	Percent	Strand
Dyak\GE14344-PA	385	GE14344-PA	1..385	1..385	2071	99.7	Plus
Dyak\GE19363-PA	354	GE19363-PA	1..349	1..380	674	41.6	Plus
Dyak\GE22198-PA	399	GE22198-PA	46..388	42..374	662	40.2	Plus
Dyak\GE20454-PA	355	GE20454-PA	1..355	1..385	658	40.8	Plus
Dyak\GE12481-PA	432	GE12481-PA	6..431	16..384	634	37	Plus

Library:	LD
Tissue Source:	Drosophila melanogaster embryo
Created by:	Ling Hong
Date Registered:	1997-12-04
Comments:	Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:	261
Well:	82
Vector:	pOT2
Associated Gene/Transcript	Galphas-RB
Protein status:	LD26182.pep: gold
Preliminary Size:	3638
Sequenced Size:	1654

Clone LD26182 Report

Clone and Library Details

Associated Genes

Clone Sequence Records

LD26182.complete Sequence

LD26182.complete Blast Records

LD26182.complete Sim4 Records

LD26182.hyp Sequence

LD26182.hyp Blast Records

LD26182.pep Sequence

LD26182.pep Blast Records