Clone LD26402 Report

Search the DGRC for LD26402

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:264
Well:2
Vector:pOT2
Associated Gene/TranscriptCG18769-RA
Protein status:LD26402.pep: gold
Preliminary Size:1851
Sequenced Size:1719

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG18769 2001-07-04 Blastp of sequenced clone
CG18769 2003-01-01 Sim4 clustering to Release 3
CG18769 2008-04-29 Release 5.5 accounting
CG18769 2008-08-15 Release 5.9 accounting
CG18769 2008-12-18 5.12 accounting

Clone Sequence Records

LD26402.complete Sequence

1719 bp (1719 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051736

> LD26402.complete
TTCGTTCGTGTCGGTTGTGGGAGTTGATGTTTTCTTATTTTATTGACAAC
TTTGAATATTAACATTCAAATACGCGCAATTTCGGTGTATATTTCCGAGA
GTATTCAGTGCTGTGGTGTAGTGTTCAATCCAGCCGTACAACCAGTTCCT
GTTAAGCGAGCCGCATCATGTCCAGAAATAGGGCTGCCATGGTCAGCGCC
TTTCGGCTCTTCCTGCGACCAGCGACCACCACCACCCATAGAAGTCTCGC
CCTGCGTTTGGCCCCCGGCACCACCTTCGCCCTGCACTTACGGCCATGTC
ATGAGCTTCAGCAGCACAGAAGCTTCGCATCCACGGCGGAGGATGGCGAA
ACGGACAAGCATAAAAAACCGACGACGGGAGAAGACATCTATGTGGAATA
CGTGAATGGCATGCCACACATGACTGTACGACTTCCCAGTCGCAATGAAC
TCTGCCAGTTTGCCCTGAAACCCATCTCCCACAACGTTGGTGATCTGTTA
GCCATGCTCAGGGCTGAGGATCGGGGCATCGATCGAGCTGCGGTGATCAA
CAAGCATGGTGTGCGAATCGCGTCGTCCTGCACCATCGAAAGCTTGCTGG
ATGACTCGTTTAGCATACAAATCAACAATCGCACATTGGATGTGAATCCT
CCCAAACGTGACAAAGTCACATTGGAGTCCATGGACAAAGTGGGCGATGT
TCGTAAGGTTATTGCTCAGCTCTACGAGGCATTCAACGTCGGAGAATATC
AGCTGGAGAAGAGCAATCAATTGGCCAAAGAACTGGAGACCCTACGCTAT
GAACTAGAACCACTGGAAGAGAAAAAACTGGAACTCAGCAAAAAGGCCGC
TCGTCGCACTAACTTTATGACTTGGATGGGTTTGGGCCTAATGTCGGTGC
AATTTGGCATTTTGGCACGACTGACTTGGTGGGAATACTCTTGGGATATT
ATGGAACCCGTTACATATTTTGTTACTTACGGGACGACAATGGCAATGTA
TGCCTACTATTGTGTCACTAAGAGGGAATATATGATGGAGGATGTGAAGA
ATCGCGAATTCTCACTTTCCCTTTATAGGAACGCCAAAAAGGTTCAGTTC
GATGTAGAACACTACAACGAACTGAAGCGAAAGTCGGCGGAGTTGGAGTA
CAATCTCAGAAGGATCAACGACCCGCTCAACATGCAATTGCCATCGCATT
TGGTTCGGACCCAGGAAAACACGCCACCAACCTTAACTGAGGAAAAGGCG
GAGCGGAAATACACTTAAGGACTTCGTAGAAAATCAGTGAAGAGACAGGG
AAAACGGAAACTCAAACTAATTTTAGCTCCCTCAAACTAGAAAACGAATA
AAAGTCCGCCTTTTAGCTAAAGAAGTTCAGGTGATCGAAATGTTGTAGTC
AAAGTAAGAAATGATTTTGTGGACGCATCACATGTTGTGTGAAATCAACT
TTAGGTTTTTCTTTACGTTAACTAAAATGTTTTAGTTGTTTATTATACGA
TTAATTAGCATAAGCCACAGTTGGACGATTCACACAAATTAACAAGGTTT
ACCGGACGCCTGCTGTATTAGAGCTTATACCATTATTTTATGTTTAATTT
TTAGTTATTTATTGCAAGTGAGAGATTTGTTTTACGCCTAAGGCAAATAT
TGTGTGTGCAGTTTTAGCAAAATATATGAATTATTTATTGACTATCATTA
AAAAAAAAAAAAAAAAAAA

LD26402.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:32:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG18769.f 3538 CG18769.f 150..1750 99..1699 8005 100 Plus
CG18769-RB 4455 CG18769-RB 1067..2667 99..1699 8005 100 Plus
CG18769-RD 3617 CG18769-RD 229..1829 99..1699 8005 100 Plus
CG18769.f 3538 CG18769.f 19..117 1..99 495 100 Plus
CG18769-RB 4455 CG18769-RB 42..140 1..99 495 100 Plus
CG18769-RD 3617 CG18769-RD 16..114 1..99 495 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 6583930..6584604 1025..1699 3300 99.3 Plus
chr3L 24539361 chr3L 6583054..6583287 380..613 1155 99.6 Plus
chr3L 24539361 chr3L 6583664..6583870 820..1026 1020 99.5 Plus
chr3L 24539361 chr3L 6544237..6544422 99..284 930 100 Plus
chr3L 24539361 chr3L 6583343..6583451 611..719 530 99.1 Plus
chr3L 24539361 chr3L 6583507..6583612 716..821 530 100 Plus
chr3L 24539361 chr3L 6543212..6543310 1..99 495 100 Plus
chr3L 24539361 chr3L 6554768..6554865 284..381 490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:06:17
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 6591478..6592152 1025..1699 3375 100 Plus
3L 28110227 3L 6590602..6590835 380..613 1170 100 Plus
3L 28110227 3L 6591212..6591418 820..1026 1035 100 Plus
3L 28110227 3L 6551764..6551949 99..284 930 100 Plus
3L 28110227 3L 6590891..6590999 611..719 545 100 Plus
3L 28110227 3L 6591055..6591160 716..821 530 100 Plus
3L 28110227 3L 6550739..6550837 1..99 495 100 Plus
3L 28110227 3L 6562321..6562418 284..381 490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 6584578..6585252 1025..1699 3375 100 Plus
3L 28103327 3L 6583702..6583935 380..613 1170 100 Plus
3L 28103327 3L 6584312..6584518 820..1026 1035 100 Plus
3L 28103327 3L 6544864..6545049 99..284 930 100 Plus
3L 28103327 3L 6583991..6584099 611..719 545 100 Plus
3L 28103327 3L 6584155..6584260 716..821 530 100 Plus
3L 28103327 3L 6543839..6543937 1..99 495 100 Plus
3L 28103327 3L 6555421..6555518 284..381 490 100 Plus
Blast to na_te.dros performed 2019-03-16 04:06:18
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3476..3533 1632..1689 137 70.7 Plus

LD26402.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:07:04 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 6583346..6583451 614..719 99 -> Plus
chr3L 6583511..6583612 720..821 100 -> Plus
chr3L 6583666..6583869 822..1025 99 -> Plus
chr3L 6543212..6543309 1..98 100 -> Plus
chr3L 6544237..6544422 99..284 100 -> Plus
chr3L 6554769..6554865 285..381 100 -> Plus
chr3L 6583056..6583287 382..613 99 -> Plus
chr3L 6583931..6584604 1026..1699 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:09:48 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RB 1..1101 168..1268 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:21:12 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RB 1..1101 168..1268 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:16:40 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RC 1..1101 168..1268 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:53:16 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RB 1..1101 168..1268 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:26:49 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RC 1..1101 168..1268 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:09:48 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RA 1..1699 1..1699 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:21:11 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RA 1..1699 1..1699 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:16:40 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RA 1..1699 1..1699 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:53:16 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RA 1..1699 1..1699 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:26:49 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
CG18769-RA 1..1699 1..1699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:07:04 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6551764..6551949 99..284 100 -> Plus
3L 6562322..6562418 285..381 100 -> Plus
3L 6590604..6590835 382..613 100 -> Plus
3L 6590894..6590999 614..719 100 -> Plus
3L 6591059..6591160 720..821 100 -> Plus
3L 6550739..6550836 1..98 100 -> Plus
3L 6591214..6591417 822..1025 100 -> Plus
3L 6591479..6592152 1026..1699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:07:04 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6551764..6551949 99..284 100 -> Plus
3L 6562322..6562418 285..381 100 -> Plus
3L 6590604..6590835 382..613 100 -> Plus
3L 6590894..6590999 614..719 100 -> Plus
3L 6591059..6591160 720..821 100 -> Plus
3L 6550739..6550836 1..98 100 -> Plus
3L 6591214..6591417 822..1025 100 -> Plus
3L 6591479..6592152 1026..1699 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:07:04 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6551764..6551949 99..284 100 -> Plus
3L 6562322..6562418 285..381 100 -> Plus
3L 6590604..6590835 382..613 100 -> Plus
3L 6590894..6590999 614..719 100 -> Plus
3L 6591059..6591160 720..821 100 -> Plus
3L 6550739..6550836 1..98 100 -> Plus
3L 6591214..6591417 822..1025 100 -> Plus
3L 6591479..6592152 1026..1699 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:16:40 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 6543839..6543936 1..98 100 -> Plus
arm_3L 6544864..6545049 99..284 100 -> Plus
arm_3L 6555422..6555518 285..381 100 -> Plus
arm_3L 6583704..6583935 382..613 100 -> Plus
arm_3L 6583994..6584099 614..719 100 -> Plus
arm_3L 6584159..6584260 720..821 100 -> Plus
arm_3L 6584314..6584517 822..1025 100 -> Plus
arm_3L 6584579..6585252 1026..1699 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:31:25 Download gff for LD26402.complete
Subject Subject Range Query Range Percent Splice Strand
3L 6543839..6543936 1..98 100 -> Plus
3L 6544864..6545049 99..284 100 -> Plus
3L 6555422..6555518 285..381 100 -> Plus
3L 6584314..6584517 822..1025 100 -> Plus
3L 6583704..6583935 382..613 100 -> Plus
3L 6583994..6584099 614..719 100 -> Plus
3L 6584159..6584260 720..821 100 -> Plus
3L 6584579..6585252 1026..1699 100   Plus

LD26402.pep Sequence

Translation from 167 to 1267

> LD26402.pep
MSRNRAAMVSAFRLFLRPATTTTHRSLALRLAPGTTFALHLRPCHELQQH
RSFASTAEDGETDKHKKPTTGEDIYVEYVNGMPHMTVRLPSRNELCQFAL
KPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSI
QINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSN
QLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILA
RLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSL
SLYRNAKKVQFDVEHYNELKRKSAELEYNLRRINDPLNMQLPSHLVRTQE
NTPPTLTEEKAERKYT*

LD26402.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:38:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23542-PA 371 GF23542-PA 1..368 1..360 1741 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15350-PA 362 GG15350-PA 1..362 1..364 1915 97.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15164-PA 302 GH15164-PA 4..286 72..354 1348 85.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
MCU-PD 366 CG18769-PD 1..366 1..366 1901 100 Plus
MCU-PB 366 CG18769-PB 1..366 1..366 1901 100 Plus
MCU-PC 366 CG18769-PC 1..366 1..366 1901 100 Plus
MCU-PA 366 CG18769-PA 1..366 1..366 1901 100 Plus
MCU-PI 365 CG18769-PI 1..365 1..366 1884 99.7 Plus
MCU-PH 457 CG18769-PH 155..457 64..366 1549 98.7 Plus
MCU-PG 443 CG18769-PG 149..443 72..366 1532 100 Plus
MCU-PE 285 CG18769-PE 1..285 82..366 1478 100 Plus
MCU-PG 443 CG18769-PG 1..72 1..72 371 98.6 Plus
MCU-PH 457 CG18769-PH 1..71 1..71 369 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12103-PA 356 GI12103-PA 58..341 71..354 1332 83.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13268-PA 371 GL13268-PA 1..361 1..364 1678 84.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28279-PA 371 GA28279-PA 1..361 1..364 1678 84.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14790-PA 363 GM14790-PA 1..363 1..364 1941 98.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13962-PA 363 GD13962-PA 1..363 1..364 1947 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13377-PA 324 GJ13377-PA 1..309 1..354 1069 58.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12545-PA 293 GK12545-PA 1..283 82..364 1363 86.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21569-PA 364 GE21569-PA 1..364 1..364 1947 98.6 Plus

LD26402.hyp Sequence

Translation from 167 to 1267

> LD26402.hyp
MSRNRAAMVSAFRLFLRPATTTTHRSLALRLAPGTTFALHLRPCHELQQH
RSFASTAEDGETDKHKKPTTGEDIYVEYVNGMPHMTVRLPSRNELCQFAL
KPISHNVGDLLAMLRAEDRGIDRAAVINKHGVRIASSCTIESLLDDSFSI
QINNRTLDVNPPKRDKVTLESMDKVGDVRKVIAQLYEAFNVGEYQLEKSN
QLAKELETLRYELEPLEEKKLELSKKAARRTNFMTWMGLGLMSVQFGILA
RLTWWEYSWDIMEPVTYFVTYGTTMAMYAYYCVTKREYMMEDVKNREFSL
SLYRNAKKVQFDVEHYNELKRKSAELEYNLRRINDPLNMQLPSHLVRTQE
NTPPTLTEEKAERKYT*

LD26402.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG18769-PD 366 CG18769-PD 1..366 1..366 1901 100 Plus
CG18769-PB 366 CG18769-PB 1..366 1..366 1901 100 Plus
CG18769-PC 366 CG18769-PC 1..366 1..366 1901 100 Plus
CG18769-PA 366 CG18769-PA 1..366 1..366 1901 100 Plus
CG18769-PI 365 CG18769-PI 1..365 1..366 1884 99.7 Plus