Clone LD26412 Report

Search the DGRC for LD26412

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:264
Well:12
Vector:pOT2
Associated Gene/TranscriptFnta-RA
Protein status:LD26412.pep: gold
Preliminary Size:1271
Sequenced Size:1204

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2976 2001-01-01 Release 2 assignment
CG2976 2002-05-31 Blastp of sequenced clone
CG2976 2003-01-01 Sim4 clustering to Release 3
CG2976 2008-04-29 Release 5.5 accounting
CG2976 2008-08-15 Release 5.9 accounting
CG2976 2008-12-18 5.12 accounting

Clone Sequence Records

LD26412.complete Sequence

1204 bp (1204 high quality bases) assembled on 2002-05-31

GenBank Submission: AY118534

> LD26412.complete
AAAAGAACAACATAAAATTCCGCCCGCACCCGCGCTCAACAGTTTTGTTT
TTAACTAACCGCGATGGGAGACAGTTCAGATGAGGAATATCTGGGCACGG
ACTGGCTGGCTTACAGCGAACGCTCCGACTGGGAAGATGTGCAACCGCTC
GCCCAGGACGACGGTCCCAATCCGGTGGTGTCCATTGCTTACAGTCAAAA
GTTTCGCGAGGTCTTCGACTACATGAGGGCCATAATTGCGCGGGGGGAGA
AGAGCCAACGTGCCTTGGACCTAACCACGGACGCACTGCGTCTGAATCCG
GCTAACTACACGGTCTGGCAATACAGACGCGACGTTCTGCGCGAACTAAA
GGCTGATCTGTATGCGGAACTGGACTATCTGACCGAGGTGATTGGCCAGA
ACTCGAAAAACTACCAGGTTTGGCACCACCGTCGCGTCATCGTCGAGATG
CTGAACGATCCCAGCAACGAGCTGGAGCTTACTGAGAACGCCCTGGTCAA
CGATGGCGATGCCAAGAACTACCACGCCTGGCAACATCGCCAGTGGGCCA
TTCGCAGCTTTAATCTCTATGACGATGAACTTAGCTTTGTGGATCGTCTC
ATTAGCGAGGATCAGCGCAACAATTCGGCCTGGAACCAGCGCTTCTTTGT
GATCAAGCATTTTGGATTCACGCCGGAGCTGATCCAGCGCGAACTGTCGT
ACACGATGAATCGCATTCGCATCATCAAAAACAACGAGAGTGCCTGGAAC
TATTTGGTGGGCGTGATGCGGCAGGGCGACAGTGGAAATGCCCTGCTGAG
CAGCTACCCGGATGTCGTGGACTTTGTGGAGGAGCTCTACCAGGCTGGCA
ATCGATCGCCCTACCTGCTGGCCTTCCTCATCGATCTCTACCAGGAGCAG
GCGCTCCAACTAAAGGCCAGCGATAGCGATCAACTCGCCCGCAAGGTGTA
CGGTCTGTGCGAGGACATGGCCACCAAACACGATGTGATTCGTCGCAAGT
ACTGGCAGTATGTGGCCAACCATCTGAAGAACCAGCTAAGCACGGTCGAA
CAGAAGTAGCAGCAGTTGTCCAGGTTACAAATCCATTATTGCTTAGTTTT
AAGCCACATACGACGTACTTAGGCCTTCTTCTTTATACATAAATAAAATT
TAATTTACCGTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

LD26412.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG2976-RA 1604 CG2976-RA 109..1272 1..1164 5820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:59:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 4828502..4829105 1162..559 2900 98.7 Minus
chr2L 23010047 chr2L 4829161..4829521 563..203 1745 98.9 Minus
chr2L 23010047 chr2L 4829590..4829791 202..1 965 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:59:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4829379..4829984 1164..559 3015 99.8 Minus
2L 23513712 2L 4830040..4830400 563..203 1805 100 Minus
2L 23513712 2L 4830469..4830670 202..1 1010 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 4829379..4829984 1164..559 3015 99.8 Minus
2L 23513712 2L 4830040..4830400 563..203 1805 100 Minus
2L 23513712 2L 4830469..4830670 202..1 1010 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:59:40 has no hits.

LD26412.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:01:13 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 4828502..4829100 564..1162 98 <- Minus
chr2L 4829161..4829521 203..563 98 <- Minus
chr2L 4829590..4829791 1..202 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:30 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 1..996 64..1059 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:34:11 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 1..996 64..1059 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:47:21 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 1..996 64..1059 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:25:46 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 1..996 64..1059 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:22:10 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
Fnta-RA 1..996 64..1059 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:05:18 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 1..1112 1..1112 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:34:11 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 17..1178 1..1162 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:47:21 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 24..1185 1..1162 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:25:46 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
CG2976-RA 1..1112 1..1112 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:22:10 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
Fnta-RA 24..1185 1..1162 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:13 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4829381..4829979 564..1162 100 <- Minus
2L 4830040..4830400 203..563 100 <- Minus
2L 4830469..4830670 1..202 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:13 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4829381..4829979 564..1162 100 <- Minus
2L 4830040..4830400 203..563 100 <- Minus
2L 4830469..4830670 1..202 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:01:13 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4829381..4829979 564..1162 100 <- Minus
2L 4830040..4830400 203..563 100 <- Minus
2L 4830469..4830670 1..202 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:47:21 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 4830469..4830670 1..202 100   Minus
arm_2L 4829381..4829979 564..1162 100 <- Minus
arm_2L 4830040..4830400 203..563 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:58:11 Download gff for LD26412.complete
Subject Subject Range Query Range Percent Splice Strand
2L 4829381..4829979 564..1162 100 <- Minus
2L 4830040..4830400 203..563 100 <- Minus
2L 4830469..4830670 1..202 100   Minus

LD26412.pep Sequence

Translation from 63 to 1058

> LD26412.pep
MGDSSDEEYLGTDWLAYSERSDWEDVQPLAQDDGPNPVVSIAYSQKFREV
FDYMRAIIARGEKSQRALDLTTDALRLNPANYTVWQYRRDVLRELKADLY
AELDYLTEVIGQNSKNYQVWHHRRVIVEMLNDPSNELELTENALVNDGDA
KNYHAWQHRQWAIRSFNLYDDELSFVDRLISEDQRNNSAWNQRFFVIKHF
GFTPELIQRELSYTMNRIRIIKNNESAWNYLVGVMRQGDSGNALLSSYPD
VVDFVEELYQAGNRSPYLLAFLIDLYQEQALQLKASDSDQLARKVYGLCE
DMATKHDVIRRKYWQYVANHLKNQLSTVEQK*

LD26412.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14417-PA 333 GF14417-PA 1..326 1..326 1575 90.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24351-PA 334 GG24351-PA 1..331 1..331 1648 92.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11478-PA 330 GH11478-PA 1..326 1..330 1337 76.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
Fnta-PB 331 CG2976-PB 1..331 1..331 1745 100 Plus
Fnta-PA 331 CG2976-PA 1..331 1..331 1745 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16973-PA 330 GI16973-PA 1..323 1..326 1385 79.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18751-PA 334 GL18751-PA 1..331 1..331 1493 82.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15551-PA 334 GA15551-PA 1..331 1..331 1494 82.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:35:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18072-PA 331 GM18072-PA 1..331 1..331 1699 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22689-PA 331 GD22689-PA 1..331 1..331 1709 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17219-PA 331 GJ17219-PA 1..321 1..326 1392 79.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24478-PA 342 GK24478-PA 1..325 1..325 1439 82.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:35:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14673-PA 334 GE14673-PA 1..331 1..331 1688 94.9 Plus

LD26412.hyp Sequence

Translation from 63 to 1058

> LD26412.hyp
MGDSSDEEYLGTDWLAYSERSDWEDVQPLAQDDGPNPVVSIAYSQKFREV
FDYMRAIIARGEKSQRALDLTTDALRLNPANYTVWQYRRDVLRELKADLY
AELDYLTEVIGQNSKNYQVWHHRRVIVEMLNDPSNELELTENALVNDGDA
KNYHAWQHRQWAIRSFNLYDDELSFVDRLISEDQRNNSAWNQRFFVIKHF
GFTPELIQRELSYTMNRIRIIKNNESAWNYLVGVMRQGDSGNALLSSYPD
VVDFVEELYQAGNRSPYLLAFLIDLYQEQALQLKASDSDQLARKVYGLCE
DMATKHDVIRRKYWQYVANHLKNQLSTVEQK*

LD26412.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Fnta-PB 331 CG2976-PB 1..331 1..331 1745 100 Plus
Fnta-PA 331 CG2976-PA 1..331 1..331 1745 100 Plus