Clone LD26511 Report

Search the DGRC for LD26511

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:265
Well:11
Vector:pOT2
Associated Gene/Transcripte(y)1-RA
Protein status:LD26511.pep: validated not full length
Preliminary Size:1177
Sequenced Size:1042

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6474 2001-01-01 Release 2 assignment
CG6474 2003-01-01 Sim4 clustering to Release 3
CG6474 2003-01-13 Blastp of sequenced clone
e(y)1 2008-04-29 Release 5.5 accounting
e(y)1 2008-08-15 Release 5.9 accounting
e(y)1 2008-12-18 5.12 accounting

Clone Sequence Records

LD26511.complete Sequence

1042 bp (1042 high quality bases) assembled on 2003-01-13

GenBank Submission: AY061338

> LD26511.complete
AAGTCCGATAAGGCCAAGATCAGTGCCCAAATCAAGCACGTGCCGAAGGA
CGCGCAGGTGATCATGTCCATCCTGAAGGAGCTGAATGTCCAGGAGTACG
AGCCGCGCGTGGTCAACCAACTGCTGGAGTTCACCTTCCGCTATGTAACC
TGCATTCTGGACGACGCCAAGGTGTACGCCAACCATGCGCGCAAGAAGAC
CATCGACTTGGACGACGTGCGTCTGGCCACCGAGGTTACGCTGGACAAGA
GCTTCACCGGGCCGTTGGAGCGCCACGTTCTAGCCAAGGTGGCCGACGTG
CGCAACAGCATGCCCCTGCCACCCATTAAGCCGCACTGCGGTCTCCGACT
GCCGCCCGACCGCTACTGTCTCACCGGCGTCAACTACAAACTGCGGGCCA
CTAATCAGCCCAAGAAAATGACCAAGTCGGCGGTGGAGGGCCGTCCACTG
AAGACCGTCGTTAAGCCCGTCTCCAGCGCCAATGGTCCGAAGAGGCCACA
CTCCGTGGTGGCCAAGCAGCAGGTGGTGACCATTCCCAAGCCCGTCATCA
AGTTTACCACCACTACGACAACGAAAACGGTGGGCAGCTCCGGCGGATCT
GGGGGCGGCGGTGGTCAGGAGGTTAAGAGCGAGAGCACCGGCGCCGGCGG
AGATCTCAAGATGGAGGTGGACAGCGATGCGGCGGCCGTGGGCAGCATCG
CTGGCGCATCCGGTTCGGGAGCAGGAAGTGCCAGCGGAGGAGGAGGAGGA
GGAGGATCATCTGGCGTTGGAGTGGCCGTCAAGCGGGAACGTGAGGAGGA
GGAGTTTGAGTTTGTGACCAACTAGCGAAACGACATCATTTACCTTAAAT
TAATATTCTTAAACCAGACCAAAGCACTTGCATTTGGTTGAGCGAACTGG
GGGTCTAAATTTCAACTCGAATGTGAAGTCCCAAAAACCTTAGTATAGAT
TCGCCCGTTAATCATTATGAAATCTACGTTTTATACACAAATACAACTAC
CAGATTTTCATATTAAAAGTTTGTAAAAAAAAAAAAAAAAAA

LD26511.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:28:00
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-RA 1169 e(y)1-RA 153..1169 1..1017 5085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:29:57
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17731819..17732696 140..1017 4345 99.7 Plus
chrX 22417052 chrX 17731616..17731755 1..140 700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:18:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17842474..17843351 140..1017 4390 100 Plus
X 23542271 X 17842271..17842410 1..140 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17850572..17851449 140..1017 4390 100 Plus
X 23527363 X 17850369..17850508 1..140 700 100 Plus
Blast to na_te.dros performed 2019-03-16 11:29:55
Subject Length Description Subject Range Query Range Score Percent Strand
Doc4-element 2791 Doc4-element DOC4 2791bp 1457..1487 772..742 110 83.9 Minus

LD26511.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:30:33 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17731616..17731754 1..139 100 -> Plus
chrX 17731819..17732696 140..1017 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:05:38 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:45 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:27:18 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:29 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:19:02 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 13..837 1..825 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:25 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 97..1113 1..1017 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:45 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 97..1110 1..1014 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:27:18 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 111..1124 1..1014 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:29 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 97..1113 1..1017 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:19:02 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)1-RA 111..1124 1..1014 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:33 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
X 17842271..17842409 1..139 100 -> Plus
X 17842474..17843351 140..1017 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:33 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
X 17842271..17842409 1..139 100 -> Plus
X 17842474..17843351 140..1017 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:30:33 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
X 17842271..17842409 1..139 100 -> Plus
X 17842474..17843351 140..1017 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:27:18 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17736304..17736442 1..139 100 -> Plus
arm_X 17736507..17737384 140..1017 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:21:00 Download gff for LD26511.complete
Subject Subject Range Query Range Percent Splice Strand
X 17850572..17851449 140..1017 100   Plus
X 17850369..17850507 1..139 100 -> Plus

LD26511.hyp Sequence

Translation from 0 to 824

> LD26511.hyp
KSDKAKISAQIKHVPKDAQVIMSILKELNVQEYEPRVVNQLLEFTFRYVT
CILDDAKVYANHARKKTIDLDDVRLATEVTLDKSFTGPLERHVLAKVADV
RNSMPLPPIKPHCGLRLPPDRYCLTGVNYKLRATNQPKKMTKSAVEGRPL
KTVVKPVSSANGPKRPHSVVAKQQVVTIPKPVIKFTTTTTTKTVGSSGGS
GGGGGQEVKSESTGAGGDLKMEVDSDAAAVGSIAGASGSGAGSASGGGGG
GGSSGVGVAVKREREEEEFEFVTN*

LD26511.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:44:00
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-PA 278 CG6474-PA 5..278 1..274 1395 100 Plus

LD26511.pep Sequence

Translation from 63 to 824

> LD26511.pep
MSILKELNVQEYEPRVVNQLLEFTFRYVTCILDDAKVYANHARKKTIDLD
DVRLATEVTLDKSFTGPLERHVLAKVADVRNSMPLPPIKPHCGLRLPPDR
YCLTGVNYKLRATNQPKKMTKSAVEGRPLKTVVKPVSSANGPKRPHSVVA
KQQVVTIPKPVIKFTTTTTTKTVGSSGGSGGGGGQEVKSESTGAGGDLKM
EVDSDAAAVGSIAGASGSGAGSASGGGGGGGSSGVGVAVKREREEEEFEF
VTN*

LD26511.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21106-PA 270 GF21106-PA 26..255 1..229 964 81.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19133-PA 275 GG19133-PA 26..233 1..208 952 93.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:30:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19399-PA 245 GH19399-PA 26..227 1..215 890 79.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)1-PA 278 CG6474-PA 26..278 1..253 1293 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22602-PA 245 GI22602-PA 26..230 1..218 885 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:30:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14751-PA 253 GL14751-PA 25..238 1..225 920 77.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:30:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26884-PA 253 GA26884-PA 25..238 1..225 927 78.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:30:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22857-PA 276 GM22857-PA 26..276 1..253 1255 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17368-PA 244 GD17368-PA 7..202 15..209 882 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:30:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23848-PA 245 GJ23848-PA 26..228 1..216 925 81 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:30:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25325-PA 270 GK25325-PA 23..270 1..253 923 73.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:30:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17689-PA 275 GE17689-PA 26..233 1..208 954 93.8 Plus