Clone LD27103 Report

Search the DGRC for LD27103

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:271
Well:3
Vector:pOT2
Associated Gene/Transcriptdnk-RA
Protein status:LD27103.pep: gold
Preliminary Size:1366
Sequenced Size:1159

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5452 2002-01-01 Sim4 clustering to Release 2
CG5452 2002-05-01 Blastp of sequenced clone
CG5452 2003-01-01 Sim4 clustering to Release 3
dnk 2008-04-29 Release 5.5 accounting
dnk 2008-08-15 Release 5.9 accounting
dnk 2008-12-18 5.12 accounting

Clone Sequence Records

LD27103.complete Sequence

1159 bp (1159 high quality bases) assembled on 2002-05-01

GenBank Submission: AY102689

> LD27103.complete
ACCAGGCGGGTTGAATCAGTCACCATATTCCCGCCGCCGTGTACAGTACT
CCATCGAATCCGGAACAATCAACTTCAACCGCGATCCGTTGCTGCTGTGC
TGTACCTAAAACAGTTAGTAAAACTCCCAATCTCACGTGCAGATCGCCGA
TTATCCGGACTGATGGCGGAGGCAGCATCCTGTGCCCGAAAGGGGACCAA
GTACGCCGAGGGCACCCAGCCCTTCACCGTCCTCATCGAGGGCAACATCG
GCAGCGGGAAGACCACGTATTTGAACCACTTCGAGAAGTACAAGAACGAC
ATTTGCCTGCTGACCGAGCCCGTCGAGAAGTGGCGCAACGTCAACGGGGT
AAATCTGCTGGAGCTGATGTACAAAGATCCCAAGAAGTGGGCCATGCCCT
TTCAGAGTTATGTCACGCTGACCATGCTGCAGTCGCACACCGCCCCAACC
AACAAGAAGCTAAAAATAATGGAGCGCTCCATTTTTAGCGCTCGCTATTG
CTTCGTGGAGAACATGCGACGAAACGGCTCGCTGGAGCAGGGCATGTACA
ATACGCTGGAGGAGTGGTACAAGTTCATCGAAGAGTCCATTCACGTGCAG
GCGGACCTCATCATATATCTGCGCACCTCGCCGGAGGTGGCGTACGAACG
CATCCGGCAGCGGGCTCGTTCTGAGGAGAGCTGCGTGCCGCTTAAGTACC
TTCAGGAGCTGCATGAGTTGCACGAGGACTGGTTGATACACCAGAGACGA
CCGCAGTCGTGCAAGGTCCTAGTCCTCGATGCCGATCTGAACCTGGAAAA
CATTGGCACCGAGTACCAGCGCTCGGAGAGCAGCATATTCGACGCCATCT
CAAGTAACCAACAGCCCTCGCCGGTTCTGGTGTCGCCCAGCAAGCGCCAG
AGGGTCGCCAGATAACCATTATCCCATTAGTACCTAATTGTGTGTAGTAC
AGACGTTTAAAATAATATTATAAGAGGCCTAGACGAGCCGATTCGCGGGA
CAAAGGCAGAAACTTACACTTCGAGCCAATGATTAACACATTCGTATATT
AACAATTATAATCCACATTATATTCTCTTCACAGCAACTAGTATGTAAGC
CCAAAATATTGTAATAAAAACTGTGAATGTTTATGTTAAAAAAAAAAAAA
AAAAAAAAA

LD27103.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
dnk-RA 1367 dnk-RA 53..1192 1..1140 5685 99.9 Plus
dnk.a 1331 dnk.a 157..1156 141..1140 4985 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14805328..14805821 1..494 2425 99.4 Plus
chr3R 27901430 chr3R 14806224..14806597 764..1137 1840 99.5 Plus
chr3R 27901430 chr3R 14805897..14806170 494..767 1370 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:19:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18981410..18981903 1..494 2470 100 Plus
3R 32079331 3R 18982306..18982682 764..1140 1870 99.7 Plus
3R 32079331 3R 18981979..18982252 494..767 1370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:40:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18722241..18722734 1..494 2470 100 Plus
3R 31820162 3R 18723137..18723513 764..1140 1870 99.7 Plus
3R 31820162 3R 18722810..18723083 494..767 1370 100 Plus
Blast to na_te.dros performed 2019-03-16 04:07:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\BuT5 669 Dbuz\BuT5 BUT5 669bp 610..663 920..974 119 70.9 Plus

LD27103.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:08:17 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14805328..14805821 1..494 99 -> Plus
chr3R 14805898..14806168 495..765 100 -> Plus
chr3R 14806226..14806597 766..1137 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:06:16 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 1..753 163..915 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:53:39 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 1..753 163..915 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:16:58 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 1..753 163..915 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:46:11 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 1..753 163..915 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:27:05 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 1..753 163..915 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:32:08 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 10..1146 1..1137 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:53:39 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 10..1146 1..1137 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:16:58 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 1..1123 15..1137 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:46:12 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 10..1146 1..1137 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:27:05 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
dnk-RA 1..1123 15..1137 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:17 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18981980..18982250 495..765 100 -> Plus
3R 18981410..18981903 1..494 100 -> Plus
3R 18982308..18982679 766..1137 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:17 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18981980..18982250 495..765 100 -> Plus
3R 18981410..18981903 1..494 100 -> Plus
3R 18982308..18982679 766..1137 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:08:17 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18981980..18982250 495..765 100 -> Plus
3R 18981410..18981903 1..494 100 -> Plus
3R 18982308..18982679 766..1137 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:16:58 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14807132..14807625 1..494 100 -> Plus
arm_3R 14807702..14807972 495..765 100 -> Plus
arm_3R 14808030..14808401 766..1137 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:18:43 Download gff for LD27103.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18722241..18722734 1..494 100 -> Plus
3R 18722811..18723081 495..765 100 -> Plus
3R 18723139..18723510 766..1137 99   Plus

LD27103.hyp Sequence

Translation from 0 to 914

> LD27103.hyp
TRRVESVTIFPPPCTVLHRIRNNQLQPRSVAAVLYLKQLVKLPISRADRR
LSGLMAEAASCARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKND
ICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPT
NKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQ
ADLIIYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRR
PQSCKVLVLDADLNLENIGTEYQRSESSIFDAISSNQQPSPVLVSPSKRQ
RVAR*

LD27103.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:24:53
Subject Length Description Subject Range Query Range Score Percent Strand
dnk-PB 250 CG5452-PB 1..250 55..304 1308 100 Plus
dnk-PA 250 CG5452-PA 1..250 55..304 1308 100 Plus

LD27103.pep Sequence

Translation from 162 to 914

> LD27103.pep
MAEAASCARKGTKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLL
TEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKL
KIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLI
IYLRTSPEVAYERIRQRARSEESCVPLKYLQELHELHEDWLIHQRRPQSC
KVLVLDADLNLENIGTEYQRSESSIFDAISSNQQPSPVLVSPSKRQRVAR
*

LD27103.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23227-PA 249 GF23227-PA 1..249 1..250 1219 89.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23099-PA 250 GG23099-PA 1..250 1..250 1322 97.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14441-PA 252 GH14441-PA 1..249 1..247 1087 79.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:38
Subject Length Description Subject Range Query Range Score Percent Strand
dnk-PB 250 CG5452-PB 1..250 1..250 1308 100 Plus
dnk-PA 250 CG5452-PA 1..250 1..250 1308 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10047-PA 252 GI10047-PA 1..251 1..249 1171 85.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23445-PA 250 GL23445-PA 1..250 1..250 1194 87.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:16:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18891-PA 250 GA18891-PA 1..250 1..250 1189 86.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13644-PA 250 GM13644-PA 1..250 1..250 1343 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:16:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19261-PA 250 GD19261-PA 1..250 1..250 1343 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22572-PA 252 GJ22572-PA 1..251 1..249 1149 83.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:16:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12063-PA 253 GK12063-PA 5..253 4..250 1156 84.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:16:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25572-PA 250 GE25572-PA 1..250 1..250 1318 97.2 Plus