Clone LD27182 Report

Search the DGRC for LD27182

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:271
Well:82
Vector:pOT2
Associated Gene/Transcript140up-RA
Protein status:LD27182.pep: gold
Preliminary Size:977
Sequenced Size:895

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9852 2001-01-01 Release 2 assignment
CG9852 2001-09-19 Blastp of sequenced clone
CG9852 2003-01-01 Sim4 clustering to Release 3
140up 2008-04-29 Release 5.5 accounting
140up 2008-08-15 Release 5.9 accounting
140up 2008-12-18 5.12 accounting

Clone Sequence Records

LD27182.complete Sequence

895 bp (895 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058577

> LD27182.complete
CACGCTTAAAAAATGAATTTTCTGTGGAAAGGACGCCGGTTTCTGATCGC
AGGCATCCTGCCAACATTCGAAGGCGCCGCAGATGAAATAGTCGATAAGG
AAAACAAAACATACAAGGCCTTTCTGGCCAGTAAACCACCAGAGGAAACA
GGACTGGAGCGCCTCAAGCAAATGTTTACAATCGACGAGTTTGGCAGCAT
ATCCTCCGAGCTTAACTCGGTTTACCAGGCCGGCTTCCTAGGATTCCTTA
TTGGAGCTATTTACGGCGGAGTTACACAATCGCGCGTGGCCTACATGAAT
TTCATGGAGAACAACCAGGCCACAGCATTTAAATCGCACTTTGATGCCAA
GAAAAAGCTGCAAGATCAATTCACAGTCAACTTTGCCAAAGGCGGCTTCA
AATGGGGCTGGCGAGTGGGACTTTTTACCACATCCTACTTCGGCATCATC
ACTTGTATGTCGGTGTACCGTGGAAAATCCTCAATCTACGAATACTTGGC
CGCTGGTTCCATCACCGGCTCGCTTTACAAAGTGAGTCTTGGTCTGCGGG
GCATGGCGGCAGGTGGAATCATTGGAGGTTTCTTGGGCGGCGTGGCTGGT
GTGACGTCGCTGCTGCTGATGAAAGCATCAGGGACCTCGATGGAAGAGGT
TCGCTACTGGCAGTACAAATGGCGACTCGATCGCGACGAAAACATTCAAC
AGGCGTTCAAAAAACTGACAGAGGACGAAAACCCAGAGCTTTTCAAGGCC
CACGACGAGAAAACATCCGAACATGTATCGCTGGACACGATCAAGTGAGT
CCTGAGGACTTAAAGAAGACGCCAGTGTGAACTTAGTTACTTTTTTTAAT
TTAAATAAATTGCATATATGTCCATCTAAAAAAAAAAAAAAAAAA

LD27182.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:19:30
Subject Length Description Subject Range Query Range Score Percent Strand
140up-RA 1153 140up-RA 69..948 1..880 4400 100 Plus
twf-RA 1376 twf-RA 1322..1376 880..826 275 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:51:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9949280..9949716 877..441 2050 97.9 Minus
chr3R 27901430 chr3R 9950158..9950342 185..1 925 100 Minus
chr3R 27901430 chr3R 9949929..9950094 351..186 830 100 Minus
chr3R 27901430 chr3R 9949779..9949869 440..350 455 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:19:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:51:40
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14124423..14124862 880..441 2200 100 Minus
3R 32079331 3R 14125304..14125488 185..1 925 100 Minus
3R 32079331 3R 14125075..14125240 351..186 830 100 Minus
3R 32079331 3R 14124925..14125015 440..350 455 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13865254..13865693 880..441 2200 100 Minus
3R 31820162 3R 13866135..13866319 185..1 925 100 Minus
3R 31820162 3R 13865906..13866071 351..186 830 100 Minus
3R 31820162 3R 13865756..13865846 440..350 455 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:51:40 has no hits.

LD27182.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:52:29 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9949280..9949716 441..877 93 <- Minus
chr3R 9949779..9949867 352..440 100 <- Minus
chr3R 9949929..9950094 186..351 100 <- Minus
chr3R 9950158..9950342 1..185 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:06:22 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 1..786 13..798 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:02:34 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 1..786 13..798 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:06:54 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 1..786 13..798 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:33:05 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 1..786 13..798 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:34:34 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 1..786 13..798 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:50:55 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 43..919 1..877 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:02:34 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 43..919 1..877 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:06:54 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 61..937 1..877 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:33:05 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 43..919 1..877 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:34:34 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
140up-RA 61..937 1..877 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:29 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14124426..14124862 441..877 100 <- Minus
3R 14124925..14125013 352..440 100 <- Minus
3R 14125075..14125240 186..351 100 <- Minus
3R 14125304..14125488 1..185 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:29 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14124426..14124862 441..877 100 <- Minus
3R 14124925..14125013 352..440 100 <- Minus
3R 14125075..14125240 186..351 100 <- Minus
3R 14125304..14125488 1..185 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:52:29 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14124426..14124862 441..877 100 <- Minus
3R 14124925..14125013 352..440 100 <- Minus
3R 14125075..14125240 186..351 100 <- Minus
3R 14125304..14125488 1..185 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:06:54 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9950148..9950584 441..877 100 <- Minus
arm_3R 9950647..9950735 352..440 100 <- Minus
arm_3R 9950797..9950962 186..351 100 <- Minus
arm_3R 9951026..9951210 1..185 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:09:52 Download gff for LD27182.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13866135..13866319 1..185 100   Minus
3R 13865257..13865693 441..877 100 <- Minus
3R 13865756..13865844 352..440 100 <- Minus
3R 13865906..13866071 186..351 100 <- Minus

LD27182.hyp Sequence

Translation from 12 to 797

> LD27182.hyp
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
TSEHVSLDTIK*

LD27182.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:39:09
Subject Length Description Subject Range Query Range Score Percent Strand
140up-PB 261 CG9852-PB 1..261 1..261 1355 100 Plus
140up-PA 261 CG9852-PA 1..261 1..261 1355 100 Plus

LD27182.pep Sequence

Translation from 12 to 797

> LD27182.pep
MNFLWKGRRFLIAGILPTFEGAADEIVDKENKTYKAFLASKPPEETGLER
LKQMFTIDEFGSISSELNSVYQAGFLGFLIGAIYGGVTQSRVAYMNFMEN
NQATAFKSHFDAKKKLQDQFTVNFAKGGFKWGWRVGLFTTSYFGIITCMS
VYRGKSSIYEYLAAGSITGSLYKVSLGLRGMAAGGIIGGFLGGVAGVTSL
LLMKASGTSMEEVRYWQYKWRLDRDENIQQAFKKLTEDENPELFKAHDEK
TSEHVSLDTIK*

LD27182.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18787-PA 261 GF18787-PA 1..261 1..261 1099 84.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21481-PA 261 GG21481-PA 1..261 1..261 1192 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19697-PA 264 GH19697-PA 1..264 1..261 1039 80.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:46
Subject Length Description Subject Range Query Range Score Percent Strand
140up-PB 261 CG9852-PB 1..261 1..261 1355 100 Plus
140up-PA 261 CG9852-PA 1..261 1..261 1355 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24553-PA 261 GI24553-PA 1..261 1..261 1032 78.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23308-PA 261 GL23308-PA 1..261 1..261 1118 86.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22073-PA 261 GA22073-PA 1..261 1..261 1105 85.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25883-PA 261 GM25883-PA 1..261 1..261 1339 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20454-PA 261 GD20454-PA 1..261 1..261 1250 96.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\140up-PA 261 GJ22619-PA 1..261 1..261 1068 80.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10906-PA 261 GK10906-PA 1..261 1..261 1037 78.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10058-PA 261 GE10058-PA 1..261 1..261 1238 95.4 Plus