Clone LD27185 Report

Search the DGRC for LD27185

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:271
Well:85
Vector:pOT2
Associated Gene/TranscriptGstO2-RB
Protein status:LD27185.pep: gold
Preliminary Size:1048
Sequenced Size:911

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6673 2001-01-01 Release 2 assignment
CG6673 2003-01-01 Sim4 clustering to Release 3
CG6673 2003-01-14 Blastp of sequenced clone
CG6673 2008-04-29 Release 5.5 accounting
CG6673 2008-08-15 Release 5.9 accounting
CG6673 2008-12-18 5.12 accounting

Clone Sequence Records

LD27185.complete Sequence

911 bp (911 high quality bases) assembled on 2003-01-14

GenBank Submission: AY061342

> LD27185.complete
TTTGCCACCAACATTTCACGTCTTGGGAATTATTTTAAAATTGTTAACAA
AATGGCCCTGCCGCAAAAGCACTTCAAGAGGGGTTCGCCCAAACCGGAGA
TCCCCGAGGATGGAGTCCTGCGTTACTATTCGATGAGATTCTGCCCGTAC
TCGCAGCGTGCCGGTTTGGTTTTGGCCGCCAAAAAGATTCCACATCACAC
GGTTTACATTGATCTTAGCGAGAAACCAGAGTGGTACATCGACTACAGTC
CATTGGGCAAGGTGCCGGCTATCCAGTTGCCAAATCTGCCTGGACAACCG
GCTTTGGTGGAGTCCCTGGTCATTGCCGAGTACTTGGATGAACAGTATCC
GGGCGAGGGCTCCCTTTTCCCCAAGGATCCATTGCAAAAGGCGCTAGACA
GGATTCTCATCGAACGCCTGTCGCCCGCTGTCAGCGCCATTTACCCCGTG
CTGTTCACCAAGAATCCACCCGCTGATGCCATCAAGAACTTTGAGACCGC
TCTGGATGTCTTCGAGCAGGAGATCACCAAGCGCGGAACACCATACTTTG
GAGGCAACAAGATCGGCATTGCTGACTACATGATTTGGCCCTGGTTCGAG
CGATTCCCGGCCCTCAAGTACACTCTGGATGAACCCTACGAGTTGGACAA
GACACGCTATCAGAATTTGTTGAAGTGGAGGGATCTGGTGGCTCAGGATG
AGGCTGTCAAGGCCACCGCTTTGGATGCCCGAATCCATGCGAAGTTCATG
AAGACCCGCCATGAGAACAAACCGGACTACGATGTAGCCTTCCAGCCCTT
GTAAAGGATGTATTAATGGATGACAGGAAGCAACATACTTAAACTAACAT
TGTGAAACCGCTTTTAAAAAAATATTAAACCCATATATAAAGTAAAAAAA
AAAAAAAAAAA

LD27185.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG6673-RB 912 CG6673-RB 20..912 1..893 4465 100 Plus
CG6673-RA 1086 CG6673-RA 152..297 1..146 490 89 Plus
CG6662.a 1263 CG6662.a 1195..1263 83..151 345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8514385..8515196 893..82 4000 99.5 Minus
chr3L 24539361 chr3L 8515373..8515456 84..1 405 98.8 Minus
chr3L 24539361 chr3L 8511882..8511986 495..599 210 80 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:19:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8522410..8523222 894..82 4065 100 Minus
3L 28110227 3L 8523399..8523482 84..1 420 100 Minus
3L 28110227 3L 8519909..8520013 495..599 195 79 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8515510..8516322 894..82 4065 100 Minus
3L 28103327 3L 8516499..8516582 84..1 420 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:36:08 has no hits.

LD27185.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:37:30 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8514385..8515195 83..893 99 <- Minus
chr3L 8515375..8515456 1..82 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:06:24 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
CG6673-RB 1..753 52..804 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:17 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
CG6673-RB 1..753 52..804 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:13:36 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
GstO2-RB 1..753 52..804 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:06 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
CG6673-RB 1..753 52..804 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:12:26 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
GstO2-RB 1..753 52..804 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:13:19 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
CG6673-RB 19..909 1..891 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:17 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
CG6673-RB 19..909 1..891 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:13:36 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
GstO2-RB 20..912 1..893 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:06 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
CG6673-RB 19..909 1..891 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:12:26 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
GstO2-RB 20..912 1..893 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:30 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8522411..8523221 83..893 100 <- Minus
3L 8523401..8523482 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:30 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8522411..8523221 83..893 100 <- Minus
3L 8523401..8523482 1..82 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:37:30 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8522411..8523221 83..893 100 <- Minus
3L 8523401..8523482 1..82 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:13:36 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8515511..8516321 83..893 100 <- Minus
arm_3L 8516501..8516582 1..82 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:29 Download gff for LD27185.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8516501..8516582 1..82 100   Minus
3L 8515511..8516321 83..893 100 <- Minus

LD27185.hyp Sequence

Translation from 0 to 803

> LD27185.hyp
FATNISRLGNYFKIVNKMALPQKHFKRGSPKPEIPEDGVLRYYSMRFCPY
SQRAGLVLAAKKIPHHTVYIDLSEKPEWYIDYSPLGKVPAIQLPNLPGQP
ALVESLVIAEYLDEQYPGEGSLFPKDPLQKALDRILIERLSPAVSAIYPV
LFTKNPPADAIKNFETALDVFEQEITKRGTPYFGGNKIGIADYMIWPWFE
RFPALKYTLDEPYELDKTRYQNLLKWRDLVAQDEAVKATALDARIHAKFM
KTRHENKPDYDVAFQPL*

LD27185.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:36
Subject Length Description Subject Range Query Range Score Percent Strand
GstO2-PB 250 CG6673-PB 1..250 18..267 1333 100 Plus
GstO2-PA 251 CG6673-PA 1..248 18..265 890 66.3 Plus
GstO3-PA 241 CG6776-PA 5..239 23..262 669 51.7 Plus
GstO1-PA 254 CG6662-PA 5..245 23..264 637 48.8 Plus
se-PA 243 CG6781-PA 5..238 23..262 620 46.7 Plus

LD27185.pep Sequence

Translation from 51 to 803

> LD27185.pep
MALPQKHFKRGSPKPEIPEDGVLRYYSMRFCPYSQRAGLVLAAKKIPHHT
VYIDLSEKPEWYIDYSPLGKVPAIQLPNLPGQPALVESLVIAEYLDEQYP
GEGSLFPKDPLQKALDRILIERLSPAVSAIYPVLFTKNPPADAIKNFETA
LDVFEQEITKRGTPYFGGNKIGIADYMIWPWFERFPALKYTLDEPYELDK
TRYQNLLKWRDLVAQDEAVKATALDARIHAKFMKTRHENKPDYDVAFQPL
*

LD27185.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10160-PA 250 GF10160-PA 1..250 1..250 1189 88.8 Plus
Dana\GF10161-PA 223 GF10161-PA 1..220 28..248 833 69.4 Plus
Dana\GF24330-PA 243 GF24330-PA 6..239 7..245 687 56.1 Plus
Dana\GF10159-PA 252 GF10159-PA 5..244 6..248 672 52.3 Plus
Dana\GF24331-PA 243 GF24331-PA 5..238 6..245 619 47.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15074-PA 250 GG15074-PA 1..250 1..250 1294 98 Plus
Dere\GG15075-PA 248 GG15075-PA 9..245 12..248 840 65.5 Plus
Dere\GG14320-PA 241 GG14320-PA 5..239 6..245 683 53.3 Plus
Dere\GG15073-PA 254 GG15073-PA 5..246 6..248 641 48.1 Plus
Dere\GG14321-PA 243 GG14321-PA 5..238 6..245 622 47.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16193-PA 249 GH16193-PA 1..249 1..250 1001 74 Plus
Dgri\GH15264-PA 241 GH15264-PA 5..239 6..245 677 52.9 Plus
Dgri\GH15265-PA 243 GH15265-PA 5..238 6..245 619 47.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
GstO2-PB 250 CG6673-PB 1..250 1..250 1333 100 Plus
GstO2-PA 251 CG6673-PA 1..248 1..248 890 66.3 Plus
GstO3-PA 241 CG6776-PA 5..239 6..245 669 51.7 Plus
GstO1-PA 254 CG6662-PA 5..245 6..247 637 48.8 Plus
se-PA 243 CG6781-PA 5..238 6..245 620 46.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13342-PA 251 GI13342-PA 5..245 6..247 948 71.5 Plus
Dmoj\GI11973-PA 241 GI11973-PA 5..239 6..245 650 50.4 Plus
Dmoj\GI11974-PA 243 GI11974-PA 5..238 6..245 611 46.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15566-PA 250 GL15566-PA 1..250 1..250 1152 84.8 Plus
Dper\GL15567-PA 246 GL15567-PA 5..245 8..248 868 66.5 Plus
Dper\GL15503-PA 241 GL15503-PA 5..239 6..245 632 48.3 Plus
Dper\GL15565-PA 253 GL15565-PA 5..245 6..248 609 47.7 Plus
Dper\GL15504-PA 243 GL15504-PA 5..238 6..245 608 46.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19769-PA 250 GA19769-PA 1..250 1..250 1158 85.2 Plus
Dpse\GA23449-PA 246 GA23449-PA 5..245 8..248 865 66.1 Plus
Dpse\GA23844-PA 241 GA23844-PA 5..239 6..245 630 48.3 Plus
Dpse\GA19859-PA 243 GA19859-PA 5..238 6..245 609 46.2 Plus
Dpse\GA19760-PA 243 GA19760-PA 5..242 6..245 603 47.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24931-PA 250 GM24931-PA 1..250 1..250 1312 99.6 Plus
Dsec\GM24932-PA 224 GM24932-PA 1..221 28..248 770 64 Plus
Dsec\GM25061-PA 241 GM25061-PA 5..239 6..245 669 52.1 Plus
Dsec\GM24930-PA 254 GM24930-PA 5..246 6..248 636 48.1 Plus
Dsec\GM25062-PA 204 GM25062-PA 5..199 6..245 489 40.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12979-PA 250 GD12979-PA 1..250 1..250 1306 99.2 Plus
Dsim\GD12980-PA 212 GD12980-PA 1..209 40..248 729 64.3 Plus
Dsim\GD14099-PA 241 GD14099-PA 5..239 6..245 638 50 Plus
Dsim\GD12978-PA 254 GD12978-PA 5..246 6..248 634 47.7 Plus
Dsim\GD14100-PA 243 GD14100-PA 5..238 6..245 618 47.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:50:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13170-PA 249 GJ13170-PA 1..247 1..248 1038 77 Plus
Dvir\GJ13171-PA 222 GJ13171-PA 1..221 28..248 786 66.2 Plus
Dvir\GJ12198-PA 241 GJ12198-PA 5..239 6..245 655 51.7 Plus
Dvir\GJ12199-PA 243 GJ12199-PA 5..238 6..245 618 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20539-PA 251 GK20539-PA 3..251 2..250 1100 81.1 Plus
Dwil\GK20540-PA 239 GK20540-PA 1..237 11..247 841 66 Plus
Dwil\GK20538-PA 259 GK20538-PA 5..251 6..248 653 50.8 Plus
Dwil\GK20355-PA 243 GK20355-PA 5..238 6..245 623 48.8 Plus
Dwil\GK20354-PA 238 GK20354-PA 4..237 2..240 591 46.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21297-PA 250 GE21297-PA 1..250 1..250 1304 98.8 Plus
Dyak\GE21298-PA 224 GE21298-PA 1..221 28..248 783 65.3 Plus
Dyak\GE20748-PA 241 GE20748-PA 5..239 6..245 686 54.2 Plus
Dyak\GE20749-PA 243 GE20749-PA 5..238 6..245 622 47.9 Plus
Dyak\GE21296-PA 254 GE21296-PA 5..246 6..248 586 45.3 Plus