Clone LD27256 Report

Search the DGRC for LD27256

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:272
Well:56
Vector:pOT2
Associated Gene/TranscriptCG8237-RA
Protein status:LD27256.pep: gold
Preliminary Size:1294
Sequenced Size:1220

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8237 2001-01-01 Release 2 assignment
CG8237 2002-03-29 Blastp of sequenced clone
CG8237 2003-01-01 Sim4 clustering to Release 3
CG8237 2008-04-29 Release 5.5 accounting
CG8237 2008-08-15 Release 5.9 accounting
CG8237 2008-12-18 5.12 accounting

Clone Sequence Records

LD27256.complete Sequence

1220 bp (1220 high quality bases) assembled on 2002-03-29

GenBank Submission: AY094806

> LD27256.complete
CAATACACGTCAACTTGTATAAATAAATAAAAGCCAGCCAAATAACAAAA
TCGATCATTGTGAGACTGAGAAAATGGGTGAACAAGGCGAGGAGACGGGT
CAGAAGCTTACGGAGCGCTCCACCAAGGAAGCCTACTTCGAAAGCCTCGC
CGAGTGGGCCAAACAGGCGACGCTGGCCCAGAATGCGATGCTCATGTTTC
CCTACTACCTGATGGCCAACTACCCGACCATGTTCCCGGGACTGCCTTCT
TCCGCTGCTCTCCAAGCAGCCGCCATGGGACAACCCCAAGCACTGGTTCA
GGGCTCGGCTGCTGCGCCGGGAGAACCAGCTGCAGAGCCTCGTTTGCCTG
CGCCAAACTTCAGCGGCCTGCGGATATTGGGCGAGGCGGCCCAGCTGGAT
ATCATACAGCGTCTTGGCGGCTACGAGTACGTTCTGTCACCTTTTTGGAA
GCGCGCCGTGGCGGAGACCATCGATATGTTCATCCTTTTCATTGTGAAAA
TCATCATTACCTTCGGGGTGGTCAACCTGTTCAACATAGAGTTCGATGAG
GACGTGATTCGGCGCACCCTGGACCAAGAAGACCTCTTTTCGAACTTCTT
TGACACATCACTAGATTTTATTTCGATGTCCACCGACCTCCTGCTAATCG
AAATGCTGACCAAGTTCATCGTTTGCTGCTACGAAGCGCTGTGGACATAC
CTATACCAAGGGGCTACGCCGGGCAAGTCGCTGATGAAGATACGCATATA
CTATGTGGAAGCAGTGATGCCGCTTCAGGGGCCGCCCCTTCCACAGTTCG
TCCTCCAGCCGCAGAGGGAGCCGATGAGGGCTCTGCTTTATCCGCCACAG
ACTCCCTCGCTGATGCGCTCCTTCGCCCGCGCGCTGATCAAGAACCTGGG
GATGACCCTGCTCTTCCCCATTTGCGTGTTGATGGTCTTCTTCAAGAACA
ATCGCACCGCCTACGACGTCCTAACCAAAACGATTGTGGTGGAGAGCAAT
TCCATTGCCGTGTTCCGCACCCAAGGGCAAGCGCAGCGCAATAATCGCTG
AGGACGGCACTTAAACCAGCCAAAGTGTGTAGGAATGGCGCACTCCTATG
CACTTCCTATGCACATATAAATAGACTTGTTAATGATAAATTTAATGTCG
TTATGTACTGCTGTCGTGTGAAATAAAATAAAATATCACATGAATACCTC
AGAAAAAAAAAAAAAAAAAA

LD27256.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG8237-RA 1202 CG8237-RA 1..1202 1..1202 6010 100 Plus
CG8235.a 1180 CG8235.a 1110..1180 1108..1038 355 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 4813240..4814441 1..1202 6010 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:19:24 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8925689..8926892 1..1204 6020 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 8926888..8928091 1..1204 6020 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:27:57 has no hits.

LD27256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:29:05 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 4813240..4814441 1..1202 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:06:28 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..978 74..1051 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:21:28 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..978 74..1051 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:57:28 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..978 74..1051 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:58:37 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..978 74..1051 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:37 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..978 74..1051 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:48:27 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..1202 1..1202 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:21:27 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..1202 1..1202 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:28 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 19..1220 1..1202 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:58:38 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 1..1202 1..1202 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:37 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
CG8237-RA 19..1220 1..1202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:05 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8925689..8926890 1..1202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:05 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8925689..8926890 1..1202 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:29:05 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8925689..8926890 1..1202 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:28 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4813194..4814395 1..1202 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:31:16 Download gff for LD27256.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8926888..8928089 1..1202 100   Plus

LD27256.pep Sequence

Translation from 73 to 1050

> LD27256.pep
MGEQGEETGQKLTERSTKEAYFESLAEWAKQATLAQNAMLMFPYYLMANY
PTMFPGLPSSAALQAAAMGQPQALVQGSAAAPGEPAAEPRLPAPNFSGLR
ILGEAAQLDIIQRLGGYEYVLSPFWKRAVAETIDMFILFIVKIIITFGVV
NLFNIEFDEDVIRRTLDQEDLFSNFFDTSLDFISMSTDLLLIEMLTKFIV
CCYEALWTYLYQGATPGKSLMKIRIYYVEAVMPLQGPPLPQFVLQPQREP
MRALLYPPQTPSLMRSFARALIKNLGMTLLFPICVLMVFFKNNRTAYDVL
TKTIVVESNSIAVFRTQGQAQRNNR*

LD27256.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12216-PA 334 GF12216-PA 1..332 1..322 1104 67.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23398-PA 329 GG23398-PA 1..328 1..323 1341 81.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23111-PA 351 GH23111-PA 52..339 14..309 799 57 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG8237-PA 325 CG8237-PA 1..325 1..325 1662 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18934-PA 340 GI18934-PA 23..323 13..309 903 61 Plus
Dmoj\GI15853-PA 310 GI15853-PA 15..301 10..309 561 44.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11681-PA 320 GL11681-PA 1..320 1..325 1095 64.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20920-PA 320 GA20920-PA 1..320 1..325 1092 63.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21078-PA 332 GM21078-PA 1..332 1..325 1558 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15381-PA 132 GD15381-PA 1..132 194..325 656 92.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21306-PA 335 GJ21306-PA 9..317 2..309 875 59.7 Plus
Dvir\GJ10341-PA 303 GJ10341-PA 22..291 16..310 697 47.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22098-PA 341 GK22098-PA 17..332 5..316 961 59.3 Plus
Dwil\GK17239-PA 320 GK17239-PA 28..313 13..317 375 32.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19239-PA 323 GE19239-PA 1..322 1..323 1306 82.7 Plus

LD27256.hyp Sequence

Translation from 73 to 1050

> LD27256.hyp
MGEQGEETGQKLTERSTKEAYFESLAEWAKQATLAQNAMLMFPYYLMANY
PTMFPGLPSSAALQAAAMGQPQALVQGSAAAPGEPAAEPRLPAPNFSGLR
ILGEAAQLDIIQRLGGYEYVLSPFWKRAVAETIDMFILFIVKIIITFGVV
NLFNIEFDEDVIRRTLDQEDLFSNFFDTSLDFISMSTDLLLIEMLTKFIV
CCYEALWTYLYQGATPGKSLMKIRIYYVEAVMPLQGPPLPQFVLQPQREP
MRALLYPPQTPSLMRSFARALIKNLGMTLLFPICVLMVFFKNNRTAYDVL
TKTIVVESNSIAVFRTQGQAQRNNR*

LD27256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8237-PA 325 CG8237-PA 1..325 1..325 1662 100 Plus