Clone LD27313 Report

Search the DGRC for LD27313

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:273
Well:13
Vector:pOT2
Associated Gene/TranscriptCG7777-RB
Protein status:LD27313.pep: gold
Preliminary Size:2287
Sequenced Size:1381

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7777 2001-01-01 Release 2 assignment
CG7777 2001-09-19 Blastp of sequenced clone
CG7777 2003-01-01 Sim4 clustering to Release 3
CG7777 2008-04-29 Release 5.5 accounting
CG7777 2008-08-15 Release 5.9 accounting
CG7777 2008-12-18 5.12 accounting

Clone Sequence Records

LD27313.complete Sequence

1381 bp (1381 high quality bases) assembled on 2001-09-19

GenBank Submission: AY058578

> LD27313.complete
GATCACTCCTCGAGTGAGCTAACAATTCCTGCCGAATTGAATTAAATATT
TGTTAAGTGCAAGTTAAGGTGTTAGCTGTTGTTGTTGCCGTTAAGTCGAG
TTCGTAAGCAGGTGGCAAAGGTGCCAAAGTGAGCTAATAGCAAAACAAGT
CCGTCAGTTTTAGTTGAAAAGTGAAGCGAAGAAGATGGGAAAATTCGAAT
ACTCACTGGGTCTCAATGAGCTCAAATCCAAGGAGCTGCGATTGTGGCAG
GCCTTGATTGGAGAATTCCTTGGCAATTTGATCCTCAATTTCTTTGCCTG
CGGCGCATGCACCCAAATTGAGGATGGCACCTTCAAGGCCTTGGCTTTTG
GCCTGGCTATCTTCATGGCCATCACGATTGTGGGCCACTTGAGTGGTGGT
CATGTGAATCCTGCCGTTACCGCTGGAATGTTGGTCGCAGGACGAATTAG
CTTGATCAGAGCCTTTTTCTATGTGGTTTTCCAGTGCTTGGGTGCAATTG
CCGGAACTGCAGCGGTTAAGATTCTCATCGATCAGGACTATTACAATGGC
CTGGGTCACACCTCTCTGGCGCCCAATATCACCGAGCTGCAGGGCCTGGG
AATCGAGTTCTTCCTGGGACTCCTGCTGGTGCTCGTCGTCTTTGGGGCCT
GTGATCCCCACAAGCCCGATTCCCGCTACACGGCGCCCTTGGCCATCGGA
ATGGCGGTGACCCTGGGTCACTTGGGCACCATCCGCTACACCGGGGCCAG
CATGAATCCCGCTCGCACCGTGGGCACCGCCTTTGCCACCGACATCTGGG
CGTCGCATTGGGTATACTGGGTGGGACCTGTGCTGGGGGGCGTGGCTGCC
GCCCTGCTCTACACCCAGGTCCTGGAGGCGAAGCCCGTGCCAAAGGTTAA
CGAGGCATCCGAGAAGTACCGAACGCACGCCGATGAACGCGAGGTGAGAG
TCAGGTTGATAAGCGCCTGGAGCGAGGAGTCCTTCTACTGATCCGTGATT
CCGCCCACCCATTACACACACACACACACACACACACCCATCACACACAC
AAACACTCACTCACACTTGCATTATGCGCAAACTGGAGGGAGCCCGTGAC
TACGCCTAGATATAAAGAAATCTTTGCGACTCGAATCTAGGGATACAGAT
GAAATCTGTGTGTTTAATCCATTCATTTCAGTGTCTAACATAAACATGTC
GTGTTCTTCTACGTTCGTGTGTATTTATGTATTTATTCATGCAAAATTCA
TTTTTAACTAACTAATATTTAATGTGTAAGCTGCCCTAAAATGCAATCTA
CAACAAAATTACTTGTACTCTCATGCGCTCACAATAAAGTGGAAAACATT
AACTGAAAAAAAAAAAAAAAAAAAAAAAAAA

LD27313.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:19:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-RB 1429 CG7777-RB 68..1429 1..1362 6795 99.9 Plus
CG7777-RA 1369 CG7777-RA 137..1079 1..943 4715 100 Plus
CG7777.a 1152 CG7777.a 70..863 150..943 3970 100 Plus
CG7777-RA 1369 CG7777-RA 1080..1368 1074..1362 1430 99.6 Plus
CG7777.a 1152 CG7777.a 864..1152 1074..1362 1430 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:26:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7328546..7329100 519..1073 2760 99.8 Plus
chr2R 21145070 chr2R 7329415..7329696 1074..1355 1410 100 Plus
chr2R 21145070 chr2R 7323752..7323900 1..149 745 100 Plus
chr2R 21145070 chr2R 7327448..7327605 219..376 745 98.1 Plus
chr2R 21145070 chr2R 7327666..7327810 376..520 725 100 Plus
chr2R 21145070 chr2R 7327276..7327348 148..220 335 97.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:19:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:26:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11441066..11441620 519..1073 2775 100 Plus
2R 25286936 2R 11441935..11442223 1074..1362 1430 99.7 Plus
2R 25286936 2R 11439968..11440125 219..376 790 100 Plus
2R 25286936 2R 11436274..11436422 1..149 745 100 Plus
2R 25286936 2R 11440186..11440330 376..520 725 100 Plus
2R 25286936 2R 11439796..11439868 148..220 365 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11442265..11442819 519..1073 2775 100 Plus
2R 25260384 2R 11443134..11443422 1074..1362 1430 99.6 Plus
2R 25260384 2R 11441167..11441324 219..376 790 100 Plus
2R 25260384 2R 11437473..11437621 1..149 745 100 Plus
2R 25260384 2R 11441385..11441529 376..520 725 100 Plus
2R 25260384 2R 11440995..11441067 148..220 365 100 Plus
Blast to na_te.dros performed on 2019-03-16 20:26:32 has no hits.

LD27313.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:27:33 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7327667..7327810 377..520 100 -> Plus
chr2R 7329415..7329696 1074..1355 100   Plus
chr2R 7328548..7329040 521..1013 99 == Plus
chr2R 7323752..7323900 1..149 100 -> Plus
chr2R 7327278..7327348 150..220 97 -> Plus
chr2R 7327450..7327605 221..376 98 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:06:32 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 1..807 185..991 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:02:35 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 1..807 185..991 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:22:44 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 1..807 185..991 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:33:06 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 1..807 185..991 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:03:03 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 1..807 185..991 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:50:57 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 29..1383 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:02:35 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 29..1382 1..1354 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:22:44 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 32..1386 1..1355 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:33:07 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 29..1383 1..1355 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:03:03 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
CG7777-RB 32..1386 1..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:33 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11436274..11436422 1..149 100 -> Plus
2R 11439798..11439868 150..220 100 -> Plus
2R 11439970..11440125 221..376 100 -> Plus
2R 11440187..11440330 377..520 100 -> Plus
2R 11441068..11441620 521..1073 100 -> Plus
2R 11441935..11442216 1074..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:33 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11436274..11436422 1..149 100 -> Plus
2R 11439798..11439868 150..220 100 -> Plus
2R 11439970..11440125 221..376 100 -> Plus
2R 11440187..11440330 377..520 100 -> Plus
2R 11441068..11441620 521..1073 100 -> Plus
2R 11441935..11442216 1074..1355 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:27:33 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11436274..11436422 1..149 100 -> Plus
2R 11439798..11439868 150..220 100 -> Plus
2R 11439970..11440125 221..376 100 -> Plus
2R 11440187..11440330 377..520 100 -> Plus
2R 11441068..11441620 521..1073 100 -> Plus
2R 11441935..11442216 1074..1355 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:22:44 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7323779..7323927 1..149 100 -> Plus
arm_2R 7327303..7327373 150..220 100 -> Plus
arm_2R 7327475..7327630 221..376 100 -> Plus
arm_2R 7327692..7327835 377..520 100 -> Plus
arm_2R 7328573..7329125 521..1073 100 -> Plus
arm_2R 7329440..7329721 1074..1355 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:09:53 Download gff for LD27313.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11442267..11442819 521..1073 100 -> Plus
2R 11443134..11443415 1074..1355 100   Plus
2R 11437473..11437621 1..149 100 -> Plus
2R 11440997..11441067 150..220 100 -> Plus
2R 11441169..11441324 221..376 100 -> Plus
2R 11441386..11441529 377..520 100 -> Plus

LD27313.hyp Sequence

Translation from 184 to 990

> LD27313.hyp
MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTF
KALAFGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQ
CLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEFFLGLLLVL
VVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF
ATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHAD
EREVRVRLISAWSEESFY*

LD27313.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:54:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG7777-PB 268 CG7777-PB 1..268 1..268 1388 100 Plus
CG7777-PA 264 CG7777-PA 1..255 1..255 1318 99.6 Plus
CG7777-PD 259 CG7777-PD 1..256 1..256 1314 98.8 Plus
CG7777-PC 270 CG7777-PC 1..253 1..253 1312 100 Plus
Drip-PE 239 CG9023-PE 1..228 1..233 473 40.4 Plus

LD27313.pep Sequence

Translation from 184 to 990

> LD27313.pep
MGKFEYSLGLNELKSKELRLWQALIGEFLGNLILNFFACGACTQIEDGTF
KALAFGLAIFMAITIVGHLSGGHVNPAVTAGMLVAGRISLIRAFFYVVFQ
CLGAIAGTAAVKILIDQDYYNGLGHTSLAPNITELQGLGIEFFLGLLLVL
VVFGACDPHKPDSRYTAPLAIGMAVTLGHLGTIRYTGASMNPARTVGTAF
ATDIWASHWVYWVGPVLGGVAAALLYTQVLEAKPVPKVNEASEKYRTHAD
EREVRVRLISAWSEESFY*

LD27313.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12555-PA 264 GF12555-PA 1..255 1..255 1247 89.4 Plus
Dana\GF12394-PA 245 GF12394-PA 7..243 1..245 459 38.9 Plus
Dana\GF11831-PA 272 GF11831-PA 20..264 12..246 355 33.5 Plus
Dana\GF11832-PA 266 GF11832-PA 13..264 13..250 317 31.3 Plus
Dana\GF12392-PA 100 GF12392-PA 3..98 109..240 308 50.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20203-PA 264 GG20203-PA 1..255 1..255 1333 99.2 Plus
Dere\GG22646-PA 245 GG22646-PA 7..243 1..245 462 39.3 Plus
Dere\GG20011-PA 271 GG20011-PA 32..262 26..246 352 34.6 Plus
Dere\GG20012-PA 294 GG20012-PA 42..293 13..258 320 29.7 Plus
Dere\GG10075-PA 694 GG10075-PA 60..280 16..233 288 34.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21387-PA 264 GH21387-PA 1..255 1..255 1172 85.1 Plus
Dgri\GH20503-PA 247 GH20503-PA 17..245 15..245 424 38.2 Plus
Dgri\GH21220-PA 267 GH21220-PA 18..267 12..251 316 32 Plus
Dgri\GH21219-PA 246 GH21219-PA 1..244 13..252 284 30.3 Plus
Dgri\GH21221-PA 259 GH21221-PA 25..257 24..244 281 30.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:13
Subject Length Description Subject Range Query Range Score Percent Strand
Prip-PB 268 CG7777-PB 1..268 1..268 1388 100 Plus
Prip-PA 264 CG7777-PA 1..255 1..255 1318 99.6 Plus
Prip-PD 259 CG7777-PD 1..256 1..256 1314 98.8 Plus
Prip-PC 270 CG7777-PC 1..253 1..253 1312 100 Plus
Drip-PF 278 CG9023-PF 7..234 1..233 475 40.9 Plus
Drip-PE 239 CG9023-PE 1..228 1..233 473 40.4 Plus
Drip-PD 242 CG9023-PD 4..231 1..233 473 40.4 Plus
Drip-PC 243 CG9023-PC 5..232 1..233 473 40.4 Plus
Drip-PB 245 CG9023-PB 7..234 1..233 473 40.4 Plus
Drip-PA 245 CG9023-PA 7..234 1..233 473 40.4 Plus
Drip-PG 233 CG9023-PG 7..232 1..231 471 40.8 Plus
Eglp3-PB 270 CG17662-PB 32..262 26..246 352 34.6 Plus
bib-PA 696 CG4722-PA 60..280 16..233 314 34.5 Plus
bib-PB 737 CG4722-PB 60..280 16..233 314 34.5 Plus
Eglp2-PA 265 CG17664-PA 13..236 13..226 303 31.4 Plus
Eglp2-PC 290 CG17664-PC 38..261 13..226 303 31.4 Plus
Eglp4-PC 261 CG4019-PC 12..257 12..250 289 30.9 Plus
Eglp4-PE 286 CG4019-PE 37..282 12..250 289 30.9 Plus
Eglp4-PF 297 CG4019-PF 48..293 12..250 289 30.9 Plus
Eglp4-PB 249 CG4019-PB 1..245 13..250 288 31 Plus
Eglp4-PD 249 CG4019-PD 1..245 13..250 288 31 Plus
Eglp4-PA 249 CG4019-PA 1..245 13..250 288 31 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18564-PA 264 GI18564-PA 1..255 1..255 1167 83.5 Plus
Dmoj\GI21049-PA 247 GI21049-PA 7..245 1..245 443 37.7 Plus
Dmoj\GI20505-PA 274 GI20505-PA 23..254 12..233 312 31.5 Plus
Dmoj\GI20506-PA 247 GI20506-PA 18..236 26..234 299 33.8 Plus
Dmoj\GI20504-PA 249 GI20504-PA 1..245 13..250 282 31.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11410-PA 123 GL11410-PA 1..113 1..113 545 91.2 Plus
Dper\GL17597-PA 272 GL17597-PA 12..264 4..246 329 32.8 Plus
Dper\GL17598-PA 266 GL17598-PA 14..259 13..252 312 31 Plus
Dper\GL17596-PA 249 GL17596-PA 1..245 13..250 291 31 Plus
Dper\GL18952-PA 691 GL18952-PA 58..278 16..233 285 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20580-PA 264 GA20580-PA 1..255 1..255 1252 91.4 Plus
Dpse\GA24443-PA 244 GA24443-PA 11..241 8..243 437 39.5 Plus
Dpse\GA24837-PA 273 GA24837-PA 18..265 9..246 322 32.3 Plus
Dpse\GA24838-PA 266 GA24838-PA 14..259 13..252 315 31 Plus
Dpse\GA17871-PA 249 GA17871-PA 1..245 13..250 290 31 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21291-PA 264 GM21291-PA 1..255 1..255 1337 99.6 Plus
Dsec\GM20426-PA 245 GM20426-PA 7..243 1..245 457 38.9 Plus
Dsec\GM15523-PA 274 GM15523-PA 32..266 26..246 335 33.6 Plus
Dsec\GM15524-PA 265 GM15524-PA 13..258 13..244 296 29.3 Plus
Dsec\GM15522-PA 261 GM15522-PA 12..257 12..250 275 30.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10798-PA 264 GD10798-PA 1..255 1..255 1337 99.6 Plus
Dsim\GD25027-PA 265 GD25027-PA 32..257 26..246 346 35 Plus
Dsim\GD25028-PA 265 GD25028-PA 13..258 13..244 295 29.3 Plus
Dsim\GD23647-PA 674 GD23647-PA 60..280 16..233 288 34.5 Plus
Dsim\GD25026-PA 261 GD25026-PA 12..257 12..250 277 30.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20358-PA 264 GJ20358-PA 1..255 1..255 1173 86.7 Plus
Dvir\GJ21971-PA 305 GJ21971-PA 69..303 8..245 451 38.8 Plus
Dvir\GJ22357-PA 247 GJ22357-PA 13..240 24..245 285 29.7 Plus
Dvir\GJ22355-PA 252 GJ22355-PA 1..234 13..258 281 30.8 Plus
Dvir\bib-PA 700 GJ17924-PA 58..278 16..233 272 33.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21417-PA 264 GK21417-PA 1..255 1..255 1220 88.6 Plus
Dwil\GK21884-PA 245 GK21884-PA 7..243 1..245 425 36.4 Plus
Dwil\GK23178-PA 270 GK23178-PA 16..265 13..253 322 31.9 Plus
Dwil\GK23177-PA 262 GK23177-PA 19..252 23..246 317 33.8 Plus
Dwil\GK23174-PA 249 GK23174-PA 1..245 13..250 309 34.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12363-PA 264 GE12363-PA 1..255 1..255 1299 96.5 Plus
Dyak\GE13520-PA 245 GE13520-PA 7..243 1..245 475 39.7 Plus
Dyak\GE11548-PA 271 GE11548-PA 32..262 26..246 362 35.5 Plus
Dyak\GE11549-PA 265 GE11549-PA 13..255 13..260 321 29.8 Plus
Dyak\GE18888-PA 699 GE18888-PA 60..280 16..233 288 34.5 Plus