Clone LD27358 Report

Search the DGRC for LD27358

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:273
Well:58
Vector:pOT2
Associated Gene/TranscriptCG10795-RA
Protein status:LD27358.pep: gold
Preliminary Size:1128
Sequenced Size:1052

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10795 2001-10-10 Blastp of sequenced clone
CG10795 2003-01-01 Sim4 clustering to Release 3
CG10795 2008-04-29 Release 5.5 accounting
CG10795 2008-08-15 Release 5.9 accounting
CG10795 2008-12-18 5.12 accounting

Clone Sequence Records

LD27358.complete Sequence

1052 bp (1052 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061343

> LD27358.complete
AAACAACAACAATTTTGGAGCCTGCCCCCGCGAACTGCAATAAACAAAAC
ATCGAAACCGGAATCGAAAACGACAACAGATAGTACCCGCGAGAAAGAGC
TCCCGCCAACAGAACACCACCACCGCCTGTCCAACCGAAGTGGCCAAAAA
GAACACCACCCATGTTCCCAGTGCTGCTGCTCCTTCTCTTCTTCTTCGCC
AAGGAAACCCACCAGATCAATGTGGACTGCAACGAGCTCCAGATGATGGG
CCAGTTCATGTGCCCCGACCCGGCGAGGGGTCAAATCGATCCCAAGACAC
AGCAGCTGGCCGGATGCACCAGGGAGGGTCGCGCCCGCGTCTGGTGCATC
GCCGCCAACGAGATCAACTGCACGGAGACTGGCAATGCCACGTTCACCCG
AGAAGTGCCCTGCAAGTGGACGAATGGCTATCACCTGGACACCACACTGC
TACTCTCTGTCTTTCTGGGCATGTTCGGCGTGGATAGATTCTATTTGGGC
TATCCGGGCATCGGACTCCTCAAGTTCTGCACCCTCGGCGGCATGTTCCT
GGGCCAGCTGATTGACATCGTGCTGATAGCCCTGCAGGTTGTGGGTCCGG
CGGATGGCTCCGCCTATGTGATACCCTACTACGGAGCCGGCATCCACATC
GTGCGCAGCGACAACACCACGTACCGGCTGCCCAGGGACGACTGGTGATG
GTTAAGGCAGCACAGCGCCTGGTGTACAGTAGATCACTTTAAGTCCTTGT
TATACCTTAAGTACGGCTTATGACACTAACGATAAGCAACGACTGCGGAT
CCGTTCCGATCGAACAATGGATCGCTTCGGTTCGGATCGAGACTCCGGAT
TAGTGCATTACGTACCCTCCTAGTTGATAAGTGTATAGATTGTTGCCACC
CTTCCTTTGCGTAGCCTAAGTTGCATTGTTTAGACTTAGTTACCAATGTA
CATGGTCCCTCATACAATTCTACATCTATGTACTTGTATAGGCCGCATAG
ACAAATTGTTTGCCAATATAACTAACGATTTTAAAAAAAAAAAAAAAAAA
AA

LD27358.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG10795-RA 1342 CG10795-RA 154..1187 1..1034 5170 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:37:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17269779..17270389 1032..422 3040 99.8 Minus
chr2R 21145070 chr2R 17270454..17270875 422..1 2095 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:19:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21383225..21383837 1034..422 3065 100 Minus
2R 25286936 2R 21383902..21384323 422..1 2110 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21384424..21385036 1034..422 3065 100 Minus
2R 25260384 2R 21385101..21385522 422..1 2110 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:37:27 has no hits.

LD27358.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:38:27 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17269779..17270389 422..1032 99 <- Minus
chr2R 17270455..17270875 1..421 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:06:38 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 1..537 162..698 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:40:03 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 1..537 162..698 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:07:22 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 1..537 162..698 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:08:52 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 1..537 162..698 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:36:08 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 1..537 162..698 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:21:35 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 19..1050 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:40:03 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 19..1050 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:07:22 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 69..1100 1..1032 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:08:52 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 19..1050 1..1032 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:36:08 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
CG10795-RA 69..1100 1..1032 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:27 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21383227..21383837 422..1032 100 <- Minus
2R 21383903..21384323 1..421 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:27 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21383227..21383837 422..1032 100 <- Minus
2R 21383903..21384323 1..421 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:27 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21383227..21383837 422..1032 100 <- Minus
2R 21383903..21384323 1..421 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:07:22 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17270732..17271342 422..1032 100 <- Minus
arm_2R 17271408..17271828 1..421 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:45:06 Download gff for LD27358.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21384426..21385036 422..1032 100 <- Minus
2R 21385102..21385522 1..421 100   Minus

LD27358.hyp Sequence

Translation from 161 to 697

> LD27358.hyp
MFPVLLLLLFFFAKETHQINVDCNELQMMGQFMCPDPARGQIDPKTQQLA
GCTREGRARVWCIAANEINCTETGNATFTREVPCKWTNGYHLDTTLLLSV
FLGMFGVDRFYLGYPGIGLLKFCTLGGMFLGQLIDIVLIALQVVGPADGS
AYVIPYYGAGIHIVRSDNTTYRLPRDDW*

LD27358.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG10795-PA 178 CG10795-PA 1..178 1..178 966 100 Plus
amx-PB 284 CG12127-PB 192..284 59..153 218 44.2 Plus
amx-PA 284 CG12127-PA 192..284 59..153 218 44.2 Plus
CG11103-PB 172 CG11103-PB 41..166 34..150 173 35.9 Plus

LD27358.pep Sequence

Translation from 161 to 697

> LD27358.pep
MFPVLLLLLFFFAKETHQINVDCNELQMMGQFMCPDPARGQIDPKTQQLA
GCTREGRARVWCIAANEINCTETGNATFTREVPCKWTNGYHLDTTLLLSV
FLGMFGVDRFYLGYPGIGLLKFCTLGGMFLGQLIDIVLIALQVVGPADGS
AYVIPYYGAGIHIVRSDNTTYRLPRDDW*

LD27358.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12097-PA 183 GF12097-PA 6..183 1..178 836 89.4 Plus
Dana\GF19095-PA 282 GF19095-PA 190..282 59..153 210 44.2 Plus
Dana\GF15960-PA 205 GF15960-PA 74..201 34..152 157 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:37:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20778-PA 178 GG20778-PA 1..178 1..178 941 98.9 Plus
Dere\GG18987-PA 285 GG18987-PA 193..285 59..153 211 44.2 Plus
Dere\GG17813-PA 223 GG17813-PA 92..219 34..152 168 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21182-PA 182 GH21182-PA 5..172 4..172 725 78.7 Plus
Dgri\GH12700-PA 275 GH12700-PA 169..275 47..153 204 40.4 Plus
Dgri\GH17747-PA 216 GH17747-PA 118..212 57..152 146 37.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG10795-PA 178 CG10795-PA 1..178 1..178 966 100 Plus
amx-PB 284 CG12127-PB 192..284 59..153 218 44.2 Plus
amx-PA 284 CG12127-PA 192..284 59..153 218 44.2 Plus
CG11103-PB 172 CG11103-PB 41..166 34..150 173 35.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:37:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20469-PA 183 GI20469-PA 14..173 12..172 746 85.7 Plus
Dmoj\GI14465-PA 268 GI14465-PA 162..268 47..153 209 41.3 Plus
Dmoj\GI15502-PA 218 GI15502-PA 87..214 34..152 151 32.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11844-PA 179 GL11844-PA 16..179 15..178 834 93.3 Plus
Dper\GL18280-PA 271 GL18280-PA 170..271 48..153 214 42.5 Plus
Dper\GL19845-PA 219 GL19845-PA 88..215 34..152 170 34.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:37:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10564-PA 179 GA10564-PA 16..179 15..178 834 93.3 Plus
Dpse\GA10761-PA 219 GA10761-PA 88..215 34..152 170 34.6 Plus
Dpse\GA11421-PA 282 GA11421-PA 170..240 48..120 143 45.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15723-PA 178 GM15723-PA 1..178 1..178 940 98.9 Plus
Dsec\GM22327-PA 286 GM22327-PA 194..286 59..153 211 44.2 Plus
Dsec\GM17641-PA 224 GM17641-PA 93..220 34..152 169 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:38:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25200-PA 178 GD25200-PA 1..178 1..178 940 98.9 Plus
Dsim\GD24561-PA 285 GD24561-PA 193..285 59..153 211 44.2 Plus
Dsim\GD17144-PA 224 GD17144-PA 93..220 34..152 169 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22319-PA 182 GJ22319-PA 14..172 13..172 753 87.5 Plus
Dvir\GJ18800-PA 268 GJ18800-PA 162..268 47..153 206 39.4 Plus
Dvir\GJ19261-PA 220 GJ19261-PA 89..216 34..152 147 32.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:38:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20744-PA 179 GK20744-PA 17..179 16..178 787 89.6 Plus
Dwil\GK25793-PA 269 GK25793-PA 177..269 59..153 218 45.3 Plus
Dwil\GK25073-PA 218 GK25073-PA 87..214 34..152 162 34.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:38:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13716-PA 178 GE13716-PA 1..178 1..178 925 97.2 Plus
Dyak\GE15460-PA 283 GE15460-PA 191..283 59..153 212 44.2 Plus
Dyak\GE17109-PA 224 GE17109-PA 93..220 34..152 164 34.6 Plus