Clone LD28068 Report

Search the DGRC for LD28068

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:280
Well:68
Vector:pOT2
Associated Gene/TranscriptCG17454-RA
Protein status:LD28068.pep: gold
Preliminary Size:1005
Sequenced Size:838

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17454 2001-01-01 Release 2 assignment
CG17454 2001-10-10 Blastp of sequenced clone
CG17454 2008-08-15 Release 5.9 accounting
CG17454 2008-12-18 5.12 accounting

Clone Sequence Records

LD28068.complete Sequence

838 bp (838 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061350

> LD28068.complete
TAAATAGTGGAATCTGACAGTACTTAAATGGCGGACGACTTGCATAATTA
TAAGCTACAATTGCAACAAGTGGAGGCAGCTCTTCAAACTGATCCAGAAA
ATGAAGAGCTATTAAAACTCAGAAGTGATCTTGACGAAGTTATTACCCTT
ACTCGTGATTTGATACAAACTCAACTGGAAGAACAAAATAAATCTTCATA
TGTGGAGCCATCATCAACCAAAAGAGATTCGTCCAACTACTTCGACGAAA
TAGAAGCAGCTCTATTAGAAGCAGAAAAATTAGTTTCAGCTGCTAAGATT
TGGAAAAAAGGAGACAAGTGTCAAGCTAAATGGAAGGAGGATCGTCAGTA
CTACGATGCAACTATTGAAGATATATCAAGTACAGGAGAAGTTAATGTAA
TATTCGATGCCTATCAAAATCGATCTACGACCCACGTCAATGAGTTGCGT
GAACGTACTATTCGCAACGAAGTTTTTCCGTCAAACAAGCGGCACAGGCC
CAATCAAAAAGAATATTTAAAAAAACGTAAGCAAAAAAAGCAACAGCGCT
TCAAGGACTTGGAAGAGGAACGTGAATCAGACAAGAACAAATGGCTTAAT
TTTAACAACAAAAACCAAAAAAAAAACGGAATGAAAGCAAGAAGTATATT
TGCGTCTCCGGATAATGTAAGCGGCAGAGTAGGAGTCGGCACTTGTGGAA
CTGCAGGAAAGGGCATGACAGATTTTACTGTGGGTGAAAAATATAGAAAA
GGTCTTTAGAATATTATCTATTAAACGGTATAATAAAAAAGGTTCATAAA
AATATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD28068.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG17454.e 2015 CG17454.e 88..899 1..812 4045 99.8 Plus
CG17454.b 1634 CG17454.b 88..899 1..812 4045 99.8 Plus
CG17454.d 2518 CG17454.d 88..899 1..812 4045 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:40:55
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 23704808..23705227 70..489 2100 100 Plus
chr3L 24539361 chr3L 23705275..23705595 485..805 1590 99.7 Plus
chr3L 24539361 chr3L 23704004..23704075 1..72 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:20:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:40:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 23715902..23716321 70..489 2100 100 Plus
3L 28110227 3L 23716369..23716696 485..812 1610 99.4 Plus
3L 28110227 3L 23715098..23715169 1..72 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 23709002..23709421 70..489 2100 100 Plus
3L 28103327 3L 23709469..23709796 485..812 1610 99.3 Plus
3L 28103327 3L 23708198..23708269 1..72 360 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:40:54 has no hits.

LD28068.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:41:36 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 23704004..23704072 1..69 100 -> Plus
chr3L 23704808..23705226 70..488 100 -> Plus
chr3L 23705279..23705595 489..805 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:07:41 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 1..732 28..759 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:22 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 1..732 28..759 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:18:05 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 1..732 28..759 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:32 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 1..732 28..759 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:50 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 1..732 28..759 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:23 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 74..878 1..805 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:22 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 74..878 1..805 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:18:05 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 76..880 1..805 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:32 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 74..878 1..805 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:50 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
CG17454-RA 76..880 1..805 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:36 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23715098..23715166 1..69 100 -> Plus
3L 23715902..23716320 70..488 100 -> Plus
3L 23716373..23716689 489..805 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:36 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23715098..23715166 1..69 100 -> Plus
3L 23715902..23716320 70..488 100 -> Plus
3L 23716373..23716689 489..805 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:36 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23715098..23715166 1..69 100 -> Plus
3L 23715902..23716320 70..488 100 -> Plus
3L 23716373..23716689 489..805 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:18:05 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 23708198..23708266 1..69 100 -> Plus
arm_3L 23709002..23709420 70..488 100 -> Plus
arm_3L 23709473..23709789 489..805 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:42 Download gff for LD28068.complete
Subject Subject Range Query Range Percent Splice Strand
3L 23709002..23709420 70..488 100 -> Plus
3L 23709473..23709789 489..805 100   Plus
3L 23708198..23708266 1..69 100 -> Plus

LD28068.pep Sequence

Translation from 27 to 758

> LD28068.pep
MADDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQL
EEQNKSSYVEPSSTKRDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQA
KWKEDRQYYDATIEDISSTGEVNVIFDAYQNRSTTHVNELRERTIRNEVF
PSNKRHRPNQKEYLKKRKQKKQQRFKDLEEERESDKNKWLNFNNKNQKKN
GMKARSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEKYRKGL*

LD28068.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22371-PA 243 GH22371-PA 1..243 1..243 1047 86 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG17454-PA 243 CG17454-PA 1..243 1..243 1258 100 Plus
CG17454-PB 230 CG17454-PB 2..230 15..243 1184 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23624-PA 1400 GI23624-PA 1172..1400 15..243 977 85.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21873-PA 243 GL21873-PA 10..243 10..243 1010 85.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:03:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26436-PA 243 GA26436-PA 1..243 1..243 1081 88.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:03:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11157-PA 243 GJ11157-PA 1..243 1..243 1041 85.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:03:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12901-PA 243 GK12901-PA 1..243 1..243 1039 84.8 Plus

LD28068.hyp Sequence

Translation from 27 to 758

> LD28068.hyp
MADDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQL
EEQNKSSYVEPSSTKRDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQA
KWKEDRQYYDATIEDISSTGEVNVIFDAYQNRSTTHVNELRERTIRNEVF
PSNKRHRPNQKEYLKKRKQKKQQRFKDLEEERESDKNKWLNFNNKNQKKN
GMKARSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEKYRKGL*

LD28068.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG17454-PA 243 CG17454-PA 1..243 1..243 1258 100 Plus
CG17454-PB 230 CG17454-PB 2..230 15..243 1184 100 Plus