LD28068.complete Sequence
838 bp (838 high quality bases) assembled on 2001-10-10
GenBank Submission: AY061350
> LD28068.complete
TAAATAGTGGAATCTGACAGTACTTAAATGGCGGACGACTTGCATAATTA
TAAGCTACAATTGCAACAAGTGGAGGCAGCTCTTCAAACTGATCCAGAAA
ATGAAGAGCTATTAAAACTCAGAAGTGATCTTGACGAAGTTATTACCCTT
ACTCGTGATTTGATACAAACTCAACTGGAAGAACAAAATAAATCTTCATA
TGTGGAGCCATCATCAACCAAAAGAGATTCGTCCAACTACTTCGACGAAA
TAGAAGCAGCTCTATTAGAAGCAGAAAAATTAGTTTCAGCTGCTAAGATT
TGGAAAAAAGGAGACAAGTGTCAAGCTAAATGGAAGGAGGATCGTCAGTA
CTACGATGCAACTATTGAAGATATATCAAGTACAGGAGAAGTTAATGTAA
TATTCGATGCCTATCAAAATCGATCTACGACCCACGTCAATGAGTTGCGT
GAACGTACTATTCGCAACGAAGTTTTTCCGTCAAACAAGCGGCACAGGCC
CAATCAAAAAGAATATTTAAAAAAACGTAAGCAAAAAAAGCAACAGCGCT
TCAAGGACTTGGAAGAGGAACGTGAATCAGACAAGAACAAATGGCTTAAT
TTTAACAACAAAAACCAAAAAAAAAACGGAATGAAAGCAAGAAGTATATT
TGCGTCTCCGGATAATGTAAGCGGCAGAGTAGGAGTCGGCACTTGTGGAA
CTGCAGGAAAGGGCATGACAGATTTTACTGTGGGTGAAAAATATAGAAAA
GGTCTTTAGAATATTATCTATTAAACGGTATAATAAAAAAGGTTCATAAA
AATATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
LD28068.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:15:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17454.e | 2015 | CG17454.e | 88..899 | 1..812 | 4045 | 99.8 | Plus |
CG17454.b | 1634 | CG17454.b | 88..899 | 1..812 | 4045 | 99.8 | Plus |
CG17454.d | 2518 | CG17454.d | 88..899 | 1..812 | 4045 | 99.8 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:40:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 23704808..23705227 | 70..489 | 2100 | 100 | Plus |
chr3L | 24539361 | chr3L | 23705275..23705595 | 485..805 | 1590 | 99.7 | Plus |
chr3L | 24539361 | chr3L | 23704004..23704075 | 1..72 | 360 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:20:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:40:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 23715902..23716321 | 70..489 | 2100 | 100 | Plus |
3L | 28110227 | 3L | 23716369..23716696 | 485..812 | 1610 | 99.4 | Plus |
3L | 28110227 | 3L | 23715098..23715169 | 1..72 | 360 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 23709002..23709421 | 70..489 | 2100 | 100 | Plus |
3L | 28103327 | 3L | 23709469..23709796 | 485..812 | 1610 | 99.3 | Plus |
3L | 28103327 | 3L | 23708198..23708269 | 1..72 | 360 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 10:40:54 has no hits.
LD28068.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:41:36 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 23704004..23704072 | 1..69 | 100 | -> | Plus |
chr3L | 23704808..23705226 | 70..488 | 100 | -> | Plus |
chr3L | 23705279..23705595 | 489..805 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:07:41 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 1..732 | 28..759 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:22 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 1..732 | 28..759 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:18:05 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 1..732 | 28..759 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:32 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 1..732 | 28..759 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:14:50 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 1..732 | 28..759 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:23 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 74..878 | 1..805 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:22 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 74..878 | 1..805 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:18:05 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 76..880 | 1..805 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:32 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 74..878 | 1..805 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:14:50 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG17454-RA | 76..880 | 1..805 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:36 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 23715098..23715166 | 1..69 | 100 | -> | Plus |
3L | 23715902..23716320 | 70..488 | 100 | -> | Plus |
3L | 23716373..23716689 | 489..805 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:36 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 23715098..23715166 | 1..69 | 100 | -> | Plus |
3L | 23715902..23716320 | 70..488 | 100 | -> | Plus |
3L | 23716373..23716689 | 489..805 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:41:36 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 23715098..23715166 | 1..69 | 100 | -> | Plus |
3L | 23715902..23716320 | 70..488 | 100 | -> | Plus |
3L | 23716373..23716689 | 489..805 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:18:05 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 23708198..23708266 | 1..69 | 100 | -> | Plus |
arm_3L | 23709002..23709420 | 70..488 | 100 | -> | Plus |
arm_3L | 23709473..23709789 | 489..805 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:42 Download gff for
LD28068.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 23709002..23709420 | 70..488 | 100 | -> | Plus |
3L | 23709473..23709789 | 489..805 | 100 | | Plus |
3L | 23708198..23708266 | 1..69 | 100 | -> | Plus |
LD28068.pep Sequence
Translation from 27 to 758
> LD28068.pep
MADDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQL
EEQNKSSYVEPSSTKRDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQA
KWKEDRQYYDATIEDISSTGEVNVIFDAYQNRSTTHVNELRERTIRNEVF
PSNKRHRPNQKEYLKKRKQKKQQRFKDLEEERESDKNKWLNFNNKNQKKN
GMKARSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEKYRKGL*
LD28068.pep Blast Records
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:03:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH22371-PA | 243 | GH22371-PA | 1..243 | 1..243 | 1047 | 86 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17454-PA | 243 | CG17454-PA | 1..243 | 1..243 | 1258 | 100 | Plus |
CG17454-PB | 230 | CG17454-PB | 2..230 | 15..243 | 1184 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:03:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI23624-PA | 1400 | GI23624-PA | 1172..1400 | 15..243 | 977 | 85.6 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:03:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL21873-PA | 243 | GL21873-PA | 10..243 | 10..243 | 1010 | 85.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:03:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26436-PA | 243 | GA26436-PA | 1..243 | 1..243 | 1081 | 88.1 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:03:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11157-PA | 243 | GJ11157-PA | 1..243 | 1..243 | 1041 | 85.2 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:03:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK12901-PA | 243 | GK12901-PA | 1..243 | 1..243 | 1039 | 84.8 | Plus |
LD28068.hyp Sequence
Translation from 27 to 758
> LD28068.hyp
MADDLHNYKLQLQQVEAALQTDPENEELLKLRSDLDEVITLTRDLIQTQL
EEQNKSSYVEPSSTKRDSSNYFDEIEAALLEAEKLVSAAKIWKKGDKCQA
KWKEDRQYYDATIEDISSTGEVNVIFDAYQNRSTTHVNELRERTIRNEVF
PSNKRHRPNQKEYLKKRKQKKQQRFKDLEEERESDKNKWLNFNNKNQKKN
GMKARSIFASPDNVSGRVGVGTCGTAGKGMTDFTVGEKYRKGL*
LD28068.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG17454-PA | 243 | CG17454-PA | 1..243 | 1..243 | 1258 | 100 | Plus |
CG17454-PB | 230 | CG17454-PB | 2..230 | 15..243 | 1184 | 100 | Plus |