BDGP Sequence Production Resources |
Search the DGRC for LD28081
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 280 |
Well: | 81 |
Vector: | pOT2 |
Associated Gene/Transcript | dUTPase-RB |
Protein status: | LD28081.pep: gold |
Sequenced Size: | 703 |
Gene | Date | Evidence |
---|---|---|
dUTPase-RB | 2009-06-22 | Replacement based on scoring |
703 bp assembled on 2009-08-05
GenBank Submission: BT089034.1
> LD28081.complete ATTTTCCGACGCTGTGTTAAACCGCGTTATTTTCAGACCAGAATTCTGCA ACTGCCAAGAAGATGAAGATCGACACGTGCGTCCTGCGATTCGCCAAACT CACCGAGAATGCTTTGGAGCCGGTGAGGGGATCCGCCAAAGCGGCGGGAG TTGACCTGCGCAGCGCCTACGACGTTGTGGTGCCGGCACGCGGAAAGGCC ATTGTCAAGACCGATCTGCAAGTGCAGGTTCCGGAGGGCTCCTACGGACG CGTAGCCCCACGATCCGGGCTGGCGGTGAAGAACTTCATTGATGTGGGCG CCGGTGTGGTGGACGAGGATTATCGCGGCAATCTCGGCGTCGTCCTGTTC AATCACTCAGATGTTGATTTCGAGGTGAAGCATGGCGACCGCATCGCCCA GTTCATTTGCGAGCGTATCTTCTATCCGCAACTGGTGATGGTGGACAAAC TGGAGGACACCGAGCGCGGCGAGGCAGGATTCGGTTCCACCGGAGTCAAG GATCTGCCGGCAGCCAAGGCGCAGAACGGCAACGGAGAAAAGGCTGCCGA ACCGGAGGGAGCTGCTCCGGCTCCTGTTGCTACGTAAACGAGGAACTATT GCCGCATTCTTAATCCCTTCATGGTCACTATCAAAGAGTTTCATTCTGTA TCCTTAAGTGAAATATGTTAATGTATTGGTATATTTTTATCTATTAAAAC CGC
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
dUTPase.e | 1264 | dUTPase.e | 141..843 | 1..703 | 3515 | 100 | Plus |
dUTPase-RB | 955 | dUTPase-RB | 141..843 | 1..703 | 3515 | 100 | Plus |
dUTPase.c | 768 | dUTPase.c | 100..753 | 50..703 | 3270 | 100 | Plus |
dUTPase.c | 768 | dUTPase.c | 37..87 | 1..51 | 255 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 11010085..11010135 | 1..51 | 100 | -> | Plus |
chr2L | 11010228..11010879 | 52..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RA | 20..567 | 38..587 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RA | 20..567 | 38..587 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RA | 20..567 | 38..587 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RA | 20..567 | 38..587 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RB | 1..700 | 4..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RB | 1..700 | 4..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RB | 37..739 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
dUTPase-RB | 18..720 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11011329..11011379 | 1..51 | 100 | -> | Plus |
2L | 11011472..11012123 | 52..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11011329..11011379 | 1..51 | 100 | -> | Plus |
2L | 11011472..11012123 | 52..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11011329..11011379 | 1..51 | 100 | -> | Plus |
2L | 11011472..11012123 | 52..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 11011329..11011379 | 1..51 | 100 | -> | Plus |
arm_2L | 11011472..11012123 | 52..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 11011472..11012123 | 52..703 | 100 | Plus | |
2L | 11011329..11011379 | 1..51 | 100 | -> | Plus |
Translation from 62 to 586
> LD28081.pep MKIDTCVLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKT DLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSD VDFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGVKDLPA AKAQNGNGEKAAEPEGAAPAPVAT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15633-PA | 212 | GF15633-PA | 15..175 | 1..161 | 786 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23694-PA | 188 | GG23694-PA | 15..188 | 1..174 | 885 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10478-PA | 171 | GH10478-PA | 1..168 | 3..164 | 717 | 83.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
dUTPase-PB | 174 | CG4584-PB | 1..174 | 1..174 | 887 | 100 | Plus |
dUTPase-PD | 174 | CG4584-PD | 1..174 | 1..174 | 887 | 100 | Plus |
dUTPase-PC | 174 | CG4584-PC | 1..174 | 1..174 | 887 | 100 | Plus |
dUTPase-PA | 188 | CG4584-PA | 15..188 | 1..174 | 887 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15982-PA | 173 | GI15982-PA | 1..170 | 1..164 | 734 | 84.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19531-PA | 187 | GL19531-PA | 15..187 | 1..174 | 801 | 92 | Plus |
Dper\GL10062-PA | 137 | GL10062-PA | 1..137 | 37..174 | 627 | 91.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA18276-PA | 187 | GA18276-PA | 15..187 | 1..174 | 809 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18802-PA | 188 | GM18802-PA | 15..188 | 1..174 | 898 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23751-PA | 188 | GD23751-PA | 15..188 | 1..174 | 898 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10455-PA | 510 | GJ10455-PA | 341..507 | 6..169 | 685 | 80.8 | Plus |
Dvir\GJ10455-PA | 510 | GJ10455-PA | 181..329 | 6..154 | 684 | 87.2 | Plus |
Dvir\GJ10455-PA | 510 | GJ10455-PA | 15..169 | 1..154 | 663 | 82.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21239-PA | 187 | GK21239-PA | 15..172 | 1..157 | 750 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\UTPase-PA | 188 | GE18505-PA | 15..188 | 1..174 | 898 | 98.9 | Plus |
Translation from 62 to 586
> LD28081.hyp MKIDTCVLRFAKLTENALEPVRGSAKAAGVDLRSAYDVVVPARGKAIVKT DLQVQVPEGSYGRVAPRSGLAVKNFIDVGAGVVDEDYRGNLGVVLFNHSD VDFEVKHGDRIAQFICERIFYPQLVMVDKLEDTERGEAGFGSTGVKDLPA AKAQNGNGEKAAEPEGAAPAPVAT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
dUTPase-PB | 174 | CG4584-PB | 1..174 | 1..174 | 887 | 100 | Plus |
dUTPase-PD | 174 | CG4584-PD | 1..174 | 1..174 | 887 | 100 | Plus |
dUTPase-PC | 174 | CG4584-PC | 1..174 | 1..174 | 887 | 100 | Plus |
dUTPase-PA | 188 | CG4584-PA | 15..188 | 1..174 | 887 | 100 | Plus |