Clone LD28404 Report

Search the DGRC for LD28404

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:284
Well:4
Vector:pOT2
Associated Gene/TranscriptCG7168-RA
Protein status:LD28404.pep: gold
Preliminary Size:1081
Sequenced Size:997

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7168 2001-01-01 Release 2 assignment
CG7168 2001-10-10 Blastp of sequenced clone
CG7168 2003-01-01 Sim4 clustering to Release 3
CG7168 2008-04-29 Release 5.5 accounting
CG7168 2008-08-15 Release 5.9 accounting
CG7168 2008-12-18 5.12 accounting

Clone Sequence Records

LD28404.complete Sequence

997 bp (997 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061355

> LD28404.complete
TAAATGTTAAGTTTATGCAGCTAAAATAAGGTGCTACTGGAGAATGCAAT
CAAAATGATGATGATGATCATAATTGAACTATTTTGGTAGTTTCCAAGTA
TGCATTTCAAACTCTAAGGGATACGCTGAAGTACAGCCGCAGGACGTAAG
TCTCAAGAAGTCAACACATCAAACTTTTTAAGTGAGGCAACCAACCACAA
AGATGTCATCTCTGCGCTTAACTCAACAACAGCGCAATCATTTGAGCCTG
CTCCAAAAACCCGCCAGCGCTGTGGTGGAGCTGTGCAAGTCCGCCTTTGA
TTACCTAATAAATGGACCCAATCCCAGCCGTTACGAGATGCTAGCCAAAA
AGTCCTCCGATTTGGGCAGTCCTGAGGCAGTGCAGCAGGCGGTGGAGGCG
CTGATATCCCTGCTCATCAGCGTGACCACCCGAGTGGGGAGCAGTTCCGT
CGACATGGAGGCCATACTGCGCCAGACATTCCCCGAACTCGGCGACGATG
TGATAGAAGTTCTCGAGCAGTTCGTCACCAGCAAACGAAACTTTGTGGAG
GGCTCAATCAAGTCGGCCAACATACGTGCCTATCGGCTGGTCAACCTGGA
CTGGCGACTGGAGGTGCGCACCGCGTCGCGGAGCCTGCTGGATCAGTGTC
AGGTGGTGGTGACTATGAAGCTATATCTGCACACCGAACCGAAGAATGAA
AACCGAGAGCTGCTGGCGGTGGACATCTCCGGGCGCAGCGAACAGGAGCT
GAAGGCCATGCAGGAGGACGAGCGGCTGCATCGAAAGGATTTGCTAGTGC
AGACGGATGTCTGCAGTCTGGTGCACATGATCAAAACGCTGGAGGACGCG
TTGGCCGAGTCCAAGACGCGGCGCATTCGCAATATTGTCGACGGAATACA
CTGATACGACTCCAGAACTCATACACTTGTTAAAGCTAATTTAATCAGGA
CCAATTTATTACAACTAAAATTAACTAGAAAAAAAAAAAAAAAAAAA

LD28404.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG7168-RA 1058 CG7168-RA 65..1043 1..979 4895 100 Plus
CG7168.a 1073 CG7168.a 220..1073 125..978 4270 100 Plus
CG7168.b 1065 CG7168.b 213..1065 126..978 4265 100 Plus
CG7168.a 1073 CG7168.a 81..205 1..125 625 100 Plus
CG7168.b 1065 CG7168.b 81..205 1..125 625 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14049196..14049993 978..181 3990 100 Minus
chr3R 27901430 chr3R 14050196..14050320 125..1 625 100 Minus
chr3R 27901430 chr3R 14050070..14050127 182..125 290 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:20:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18224901..18225699 979..181 3995 100 Minus
3R 32079331 3R 18225902..18226026 125..1 625 100 Minus
3R 32079331 3R 18225776..18225833 182..125 290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17965732..17966530 979..181 3995 100 Minus
3R 31820162 3R 17966733..17966857 125..1 625 100 Minus
3R 31820162 3R 17966607..17966664 182..125 290 100 Minus
Blast to na_te.dros performed on 2019-03-15 13:37:44 has no hits.

LD28404.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:38:35 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14049196..14049991 183..978 100 <- Minus
chr3R 14050070..14050126 126..182 100 <- Minus
chr3R 14050196..14050320 1..125 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:06 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 1..702 203..904 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:23 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 1..702 203..904 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:07:43 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 1..702 203..904 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:33 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 1..702 203..904 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:36:24 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 1..702 203..904 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:24 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 22..200 1..179 100 == Plus
CG7168-RA 201..979 200..978 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:23 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 22..999 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:07:43 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 57..1034 1..978 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:34 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 22..200 1..179 100 == Plus
CG7168-RA 201..979 200..978 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:36:24 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
CG7168-RA 57..1034 1..978 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:35 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18225902..18226026 1..125 100   Minus
3R 18224902..18225697 183..978 100 <- Minus
3R 18225776..18225832 126..182 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:35 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18225902..18226026 1..125 100   Minus
3R 18224902..18225697 183..978 100 <- Minus
3R 18225776..18225832 126..182 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:35 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18225902..18226026 1..125 100   Minus
3R 18224902..18225697 183..978 100 <- Minus
3R 18225776..18225832 126..182 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:07:43 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14050624..14051419 183..978 100 <- Minus
arm_3R 14051498..14051554 126..182 100 <- Minus
arm_3R 14051624..14051748 1..125 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:43 Download gff for LD28404.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17965733..17966528 183..978 100 <- Minus
3R 17966607..17966663 126..182 100 <- Minus
3R 17966733..17966857 1..125 100   Minus

LD28404.pep Sequence

Translation from 202 to 903

> LD28404.pep
MSSLRLTQQQRNHLSLLQKPASAVVELCKSAFDYLINGPNPSRYEMLAKK
SSDLGSPEAVQQAVEALISLLISVTTRVGSSSVDMEAILRQTFPELGDDV
IEVLEQFVTSKRNFVEGSIKSANIRAYRLVNLDWRLEVRTASRSLLDQCQ
VVVTMKLYLHTEPKNENRELLAVDISGRSEQELKAMQEDERLHRKDLLVQ
TDVCSLVHMIKTLEDALAESKTRRIRNIVDGIH*

LD28404.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23154-PA 233 GF23154-PA 1..233 1..233 966 83.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:03:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16629-PA 233 GG16629-PA 1..233 1..233 1158 94 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:03:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19033-PA 228 GH19033-PA 1..228 1..233 891 75.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG7168-PA 233 CG7168-PA 1..233 1..233 1149 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22845-PA 231 GI22845-PA 1..231 1..233 888 73.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12601-PA 177 GL12601-PA 108..177 164..233 295 82.9 Plus
Dper\GL12601-PA 177 GL12601-PA 1..73 1..71 148 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20150-PA 234 GA20150-PA 1..234 1..233 1016 83.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15316-PA 233 GM15316-PA 1..233 1..233 1181 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:03:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20193-PA 233 GD20193-PA 1..233 1..233 1185 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24704-PA 231 GJ24704-PA 1..231 1..233 909 74.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22787-PA 239 GK22787-PA 3..239 6..233 887 70.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25227-PA 233 GE25227-PA 1..233 1..233 1134 91.8 Plus

LD28404.hyp Sequence

Translation from 202 to 903

> LD28404.hyp
MSSLRLTQQQRNHLSLLQKPASAVVELCKSAFDYLINGPNPSRYEMLAKK
SSDLGSPEAVQQAVEALISLLISVTTRVGSSSVDMEAILRQTFPELGDDV
IEVLEQFVTSKRNFVEGSIKSANIRAYRLVNLDWRLEVRTASRSLLDQCQ
VVVTMKLYLHTEPKNENRELLAVDISGRSEQELKAMQEDERLHRKDLLVQ
TDVCSLVHMIKTLEDALAESKTRRIRNIVDGIH*

LD28404.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG7168-PA 233 CG7168-PA 1..233 1..233 1149 100 Plus