Clone LD28544 Report

Search the DGRC for LD28544

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:285
Well:44
Vector:pOT2
Associated Gene/TranscriptcN-IIIB-RA
Protein status:LD28544.pep: gold
Preliminary Size:1624
Sequenced Size:1505

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3362 2001-01-01 Release 2 assignment
CG3362 2001-10-10 Blastp of sequenced clone
CG3362 2003-01-01 Sim4 clustering to Release 3
CG3362 2008-04-29 Release 5.5 accounting
CG3362 2008-08-15 Release 5.9 accounting
CG3362 2008-12-18 5.12 accounting

Clone Sequence Records

LD28544.complete Sequence

1505 bp (1505 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061358

> LD28544.complete
TTTAAACTAAATCCATTGTTGTTTACACAGCGCTTTAACTAAATTTTGGA
CACAGTCTATATCAATAAAAGCTTGTCACGGCGGAGCTTCGATAGCCAGC
TGATAACTGCGAGTGCTGCAACAAGACCAACAAAGTTGGCAAAATACTCC
TCCAAGGTCAGCCTTAGATATAGAGCCAACAGCACAGGTGATCGGCATAA
ATCGCTTGCCTAAACAATTTGCAAATATCGTTGGTATCGATCGCGGTGAT
CTATTCGCACAGAGTGCAGACACTCTGTCACTGTGATCAGGGGAAGACCT
CTCAGCTGCTGGACGAGAAGACTGCTCAAAATGGGCTTTGACGAGAAGCG
TGAGCCCACCGGCGGCAGACTGCGACTGCAGGACATTCCGGCCCTCACCC
AGGACCACTGCCGCATGCGGGATCCGGCGGAGGTGGAGCGCATCATCAAC
GAGTTCGTCATCGGCGGACCAGAGCGCATGCAAATCGTCTCCGACTTCGA
CTACACCATCACCAAGCAGCGCACGGAGGATGGAGGAGCAGTGCCCTCCA
GTTTCGGGATCTTCAACGCCTGCCAGTCGCTGCCGGAAAACTTTAAGGCG
GAGACGGACAAGCTGTACCACAAGTACCGGCCCATTGAGATCGATCCCCA
CATGCCCATCGCCGAGAAGGTGCAGTACATGATCGAGTGGTGGACCAAGT
CTGGCGAACTGACCAGCGGCTTCCCCTTCGACCAGTCGGAAATAGATCAG
ATAGCCAGCAAGTACACGCATGCGCTACGTGACCGCACCCACGAGTTCTT
TGCGGACCTCCAGCGCTTGGGCATTCCCACGCTTGTCTTCTCCGCCGGGC
TGGGCAACTCGGTGGTCTCGGTTCTTCGCCAGGCCAACGTTTTGCATCCG
AACGTGAAGGTAGTCTCGAACTTTCTTCAGTTCCGGGATGGCCTTCTAGA
TGGCTTTCAGCAGCCGATGATACACACCTTCAACAAGAACGAAACGGTGC
TAAATGAGACCAGCGAGTATTACGACTTGGTGCACACCAGGGACCACATC
ATAGTCATGGGCGACTCAATTGGTGATGCAGACATGGCCTCCGGGGTGCC
TGCCTCCTCACACATCATGAAAATCGGCTTCCTCTTCGACCACGTAGAAG
CCAACATGAAGAAGTACATGGACACCTTTGACATAGTGCTCGTCGATGAC
CAGACCATGGACGTGCCCAGGACCCTGCTCTCCCTCATCGAGAAGCAACA
CAAGCTGAACCTGGAGGCCCCCAAGCAGAGCTCCCTATAATTCCCGCAGG
GAGTTCACGAATTCACTCTGAAATGTACTCGTGCCGCTTCTGCTCTCTCA
TTAGCAGGCTAGTTGCTGACCGGAACACAACAGAAGCTACTAATTAGGTG
GTTAGGCTTAAACATTCTACTCATCTTAACGAATGAATGTATACTTCATG
GACACAAATTATATTAAAGACAACTTTGTGCATTGCAAAAAAAAAAAAAA
AAAAA

LD28544.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG3362-RA 1488 CG3362-RA 1..1488 1..1488 7440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:30:21
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 20081560..20083045 1..1486 7340 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:21:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 24195542..24197030 1..1489 7445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 24196741..24198229 1..1489 7445 100 Plus
Blast to na_te.dros performed on 2019-03-15 19:30:19 has no hits.

LD28544.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:31:07 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 20081560..20083045 1..1486 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:16 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 1..960 331..1290 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:54:29 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 1..960 331..1290 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:58:16 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 1..960 331..1290 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:23:29 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 1..960 331..1290 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:02 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
cN-IIIB-RA 1..960 331..1290 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:39:55 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 1..1486 1..1486 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:54:29 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 1..1486 1..1486 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:58:16 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 45..1530 1..1486 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:23:30 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
CG3362-RA 1..1486 1..1486 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:02 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
cN-IIIB-RA 45..1530 1..1486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:31:07 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24195542..24197027 1..1486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:31:07 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24195542..24197027 1..1486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:31:07 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24195542..24197027 1..1486 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:58:16 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 20083065..20084550 1..1486 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:00:38 Download gff for LD28544.complete
Subject Subject Range Query Range Percent Splice Strand
2R 24196759..24198244 1..1486 100   Plus

LD28544.hyp Sequence

Translation from 330 to 1289

> LD28544.hyp
MGFDEKREPTGGRLRLQDIPALTQDHCRMRDPAEVERIINEFVIGGPERM
QIVSDFDYTITKQRTEDGGAVPSSFGIFNACQSLPENFKAETDKLYHKYR
PIEIDPHMPIAEKVQYMIEWWTKSGELTSGFPFDQSEIDQIASKYTHALR
DRTHEFFADLQRLGIPTLVFSAGLGNSVVSVLRQANVLHPNVKVVSNFLQ
FRDGLLDGFQQPMIHTFNKNETVLNETSEYYDLVHTRDHIIVMGDSIGDA
DMASGVPASSHIMKIGFLFDHVEANMKKYMDTFDIVLVDDQTMDVPRTLL
SLIEKQHKLNLEAPKQSSL*

LD28544.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:57:21
Subject Length Description Subject Range Query Range Score Percent Strand
cN-IIIB-PA 319 CG3362-PA 1..319 1..319 1669 100 Plus

LD28544.pep Sequence

Translation from 330 to 1289

> LD28544.pep
MGFDEKREPTGGRLRLQDIPALTQDHCRMRDPAEVERIINEFVIGGPERM
QIVSDFDYTITKQRTEDGGAVPSSFGIFNACQSLPENFKAETDKLYHKYR
PIEIDPHMPIAEKVQYMIEWWTKSGELTSGFPFDQSEIDQIASKYTHALR
DRTHEFFADLQRLGIPTLVFSAGLGNSVVSVLRQANVLHPNVKVVSNFLQ
FRDGLLDGFQQPMIHTFNKNETVLNETSEYYDLVHTRDHIIVMGDSIGDA
DMASGVPASSHIMKIGFLFDHVEANMKKYMDTFDIVLVDDQTMDVPRTLL
SLIEKQHKLNLEAPKQSSL*

LD28544.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11383-PA 320 GF11383-PA 1..320 1..319 1485 86.3 Plus
Dana\GF11380-PA 309 GF11380-PA 15..308 14..308 1113 67.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22952-PA 319 GG22952-PA 1..319 1..319 1594 92.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20977-PA 320 GH20977-PA 7..303 12..309 1237 75.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:57
Subject Length Description Subject Range Query Range Score Percent Strand
cN-IIIB-PA 319 CG3362-PA 1..319 1..319 1669 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21312-PA 331 GI21312-PA 7..311 4..309 1287 75.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19990-PA 318 GL19990-PA 1..318 1..319 1469 84.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17406-PA 318 GA17406-PA 1..318 1..319 1469 84.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18318-PA 319 GM18318-PA 1..319 1..319 1671 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11843-PA 319 GD11843-PA 1..319 1..319 1682 97.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21581-PA 328 GJ21581-PA 10..311 7..309 1340 81.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15779-PA 322 GK15779-PA 1..310 1..312 1280 77.7 Plus
Dwil\GK15781-PA 271 GK15781-PA 9..271 4..309 310 26.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14389-PA 319 GE14389-PA 1..319 1..319 1646 95.9 Plus