Clone LD28549 Report

Search the DGRC for LD28549

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:285
Well:49
Vector:pOT2
Associated Gene/TranscriptCG10973-RB
Protein status:LD28549.pep: gold
Preliminary Size:1083
Sequenced Size:1004

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10973 2001-01-01 Release 2 assignment
CG10973 2001-10-10 Blastp of sequenced clone
CG10973 2003-01-01 Sim4 clustering to Release 3
CG10973 2008-04-29 Release 5.5 accounting
CG10973 2008-08-15 Release 5.9 accounting
CG10973 2008-12-18 5.12 accounting

Clone Sequence Records

LD28549.complete Sequence

1004 bp (1004 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061359

> LD28549.complete
ATTTCCCAAAATGACCGATCCAAACGTGCCAAGAGGAGCCCTAAGCTTGC
AGAATGTTCTGAAATATACGGTGCAACACCACGATCCAAATCCAGAAGCA
GCCCCAAAGTTGGAAACTCCCGATCCTGAGAGAGCTCAGTTTTTGGCAAA
TGCCCTAAATGCCATGACAGTGGATGCTGCAGCGGCCCTGAAAGCAGCTT
TGGTGATCTTGAACAGCGAAGAATCCAGCACGGACGACCAAATCGAGAGT
CTGGATGTCATAAGGAGCCACATCGATGACATCGACAATGCCATAACGCT
GGTGAAGCTAGGAGGAACTGCAACTCTACTCCGCTACATAACACATTCGG
ATAGCGAAGTGCGAGAATCGGCACTCAATACTGTCGCTGAAGTGGCCCAG
AATAATGTATTTTGTCAGAACGCCCTCATAAACGATAAGTTTTTGCCTGC
ACTTGCAAAGAACTTGAGCCATTCGAATCCGAATACCGTGCGGTGCTCCT
TGTATGCGATATCATCGCTGATAAGGAACTTTCAGCCTGGATACGACGAG
TTTAAGCGCATAAAGGGGATCAGGTCCTTGATACCCTGTCTGAAATCCAC
AAATACAAATGTCTACGTGAAGACTGCTTTTCTAATTGCATCGTTAACTT
CAATCGAGAAGTCTGTCAGAGATGATTTTGTGAAGGAAGAAGTGTTTCCT
GTGCTAGTGGAAAACCTTAAGCCCGTTGATGACTTTGATATCAAACAAGA
AACTACGCTTTTTGCACTTTCATCTCTTTCGCGGGAATCGGAGTTAAAAC
TCTCTACGGAAAAACGAGAGGAAATCCTATCGAAGCTTCAACAAATTATT
TCCAAAAACAAACAGTCGGAAACGTGTGAAGACATGGTTAATTATGCAAG
AAATATTTTTGACAACTTAAGTGCACATTAAAAACAAATCGATTTTTCAC
GTAAATGTTAAGTTAAATAAAATGGGCTTTGAAAGTAAAAAAAAAAAAAA
AAAA

LD28549.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG10973-RB 1148 CG10973-RB 162..1148 1..987 4935 100 Plus
CG10973-RA 1085 CG10973-RA 143..1079 51..987 4685 100 Plus
CG10984-RA 2365 CG10984-RA 2156..2262 987..881 535 100 Minus
CG10973-RA 1085 CG10973-RA 36..87 1..52 260 100 Plus
CG10984-RA 2365 CG10984-RA 2322..2365 881..838 220 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12744051..12744593 671..129 2715 100 Minus
chr3L 24539361 chr3L 12743779..12743990 881..670 1060 100 Minus
chr3L 24539361 chr3L 12743614..12743719 986..881 530 100 Minus
chr3L 24539361 chr3L 12744917..12744996 130..51 400 100 Minus
chr3L 24539361 chr3L 12745052..12745103 52..1 260 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:21:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:36:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12753676..12754218 671..129 2715 100 Minus
3L 28110227 3L 12753404..12753615 881..670 1060 100 Minus
3L 28110227 3L 12753238..12753344 987..881 535 100 Minus
3L 28110227 3L 12754542..12754621 130..51 400 100 Minus
3L 28110227 3L 12754677..12754728 52..1 260 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:29:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12746776..12747318 671..129 2715 100 Minus
3L 28103327 3L 12746504..12746715 881..670 1060 100 Minus
3L 28103327 3L 12746338..12746444 987..881 535 100 Minus
3L 28103327 3L 12747642..12747721 130..51 400 100 Minus
3L 28103327 3L 12747777..12747828 52..1 260 100 Minus
Blast to na_te.dros performed 2019-03-16 16:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy3 6973 gypsy3 GYPSY3 6973bp 435..577 980..843 109 55.2 Minus

LD28549.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:37:47 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12743780..12743988 672..880 100 <- Minus
chr3L 12743614..12743719 881..986 100 <- Minus
chr3L 12744051..12744591 131..671 100 <- Minus
chr3L 12744917..12744994 53..130 100 <- Minus
chr3L 12745052..12745103 1..52 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:18 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..921 11..931 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:39:51 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..921 11..931 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:00 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..921 11..931 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:08:40 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..921 11..931 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:35:40 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..921 11..931 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:21:21 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..986 1..986 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:39:51 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..986 1..986 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:00 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 47..1032 1..986 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:08:41 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 1..986 1..986 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:35:40 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
CG10973-RB 47..1032 1..986 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:37:47 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12753239..12753344 881..986 100 <- Minus
3L 12753405..12753613 672..880 100 <- Minus
3L 12753676..12754216 131..671 100 <- Minus
3L 12754542..12754619 53..130 100 <- Minus
3L 12754677..12754728 1..52 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:37:47 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12753239..12753344 881..986 100 <- Minus
3L 12753405..12753613 672..880 100 <- Minus
3L 12753676..12754216 131..671 100 <- Minus
3L 12754542..12754619 53..130 100 <- Minus
3L 12754677..12754728 1..52 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:37:47 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12753239..12753344 881..986 100 <- Minus
3L 12753405..12753613 672..880 100 <- Minus
3L 12753676..12754216 131..671 100 <- Minus
3L 12754542..12754619 53..130 100 <- Minus
3L 12754677..12754728 1..52 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:00 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12746339..12746444 881..986 100 <- Minus
arm_3L 12746505..12746713 672..880 100 <- Minus
arm_3L 12746776..12747316 131..671 100 <- Minus
arm_3L 12747642..12747719 53..130 100 <- Minus
arm_3L 12747777..12747828 1..52 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:44:54 Download gff for LD28549.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12746505..12746713 672..880 100 <- Minus
3L 12746776..12747316 131..671 100 <- Minus
3L 12747642..12747719 53..130 100 <- Minus
3L 12747777..12747828 1..52 100   Minus
3L 12746339..12746444 881..986 100 <- Minus

LD28549.hyp Sequence

Translation from 0 to 930

> LD28549.hyp
FPKMTDPNVPRGALSLQNVLKYTVQHHDPNPEAAPKLETPDPERAQFLAN
ALNAMTVDAAAALKAALVILNSEESSTDDQIESLDVIRSHIDDIDNAITL
VKLGGTATLLRYITHSDSEVRESALNTVAEVAQNNVFCQNALINDKFLPA
LAKNLSHSNPNTVRCSLYAISSLIRNFQPGYDEFKRIKGIRSLIPCLKST
NTNVYVKTAFLIASLTSIEKSVRDDFVKEEVFPVLVENLKPVDDFDIKQE
TTLFALSSLSRESELKLSTEKREEILSKLQQIISKNKQSETCEDMVNYAR
NIFDNLSAH*

LD28549.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:55:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG10973-PB 306 CG10973-PB 1..306 4..309 1530 100 Plus

LD28549.pep Sequence

Translation from 10 to 930

> LD28549.pep
MTDPNVPRGALSLQNVLKYTVQHHDPNPEAAPKLETPDPERAQFLANALN
AMTVDAAAALKAALVILNSEESSTDDQIESLDVIRSHIDDIDNAITLVKL
GGTATLLRYITHSDSEVRESALNTVAEVAQNNVFCQNALINDKFLPALAK
NLSHSNPNTVRCSLYAISSLIRNFQPGYDEFKRIKGIRSLIPCLKSTNTN
VYVKTAFLIASLTSIEKSVRDDFVKEEVFPVLVENLKPVDDFDIKQETTL
FALSSLSRESELKLSTEKREEILSKLQQIISKNKQSETCEDMVNYARNIF
DNLSAH*

LD28549.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10869-PA 307 GF10869-PA 1..307 1..306 1119 69.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13807-PA 306 GG13807-PA 1..306 1..306 1545 96.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16834-PA 264 GH16834-PA 1..262 41..304 518 41.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG10973-PB 306 CG10973-PB 1..306 1..306 1530 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13055-PA 292 GI13055-PA 1..290 13..304 543 40.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:36:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24934-PA 308 GL24934-PA 1..304 1..303 893 57.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10680-PA 308 GA10680-PA 1..304 1..303 892 57.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:36:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24633-PA 306 GM24633-PA 1..306 1..306 1583 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12702-PA 306 GD12702-PA 1..306 1..306 1583 98.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13802-PA 252 GJ13802-PA 6..250 60..304 521 43.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20262-PA 312 GK20262-PA 2..302 3..302 663 49 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20100-PA 306 GE20100-PA 1..306 1..306 1467 93.8 Plus