Clone LD28566 Report

Search the DGRC for LD28566

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:285
Well:66
Vector:pOT2
Associated Gene/TranscriptCG4278-RA
Protein status:LD28566.pep: gold
Preliminary Size:1140
Sequenced Size:1035

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4278 2001-01-01 Release 2 assignment
CG4278 2003-01-01 Sim4 clustering to Release 3
CG4278 2003-05-21 Blastp of sequenced clone
CG4278 2008-04-29 Release 5.5 accounting
CG4278 2008-08-15 Release 5.9 accounting
CG4278 2008-12-18 5.12 accounting

Clone Sequence Records

LD28566.complete Sequence

1035 bp (1035 high quality bases) assembled on 2003-05-21

GenBank Submission: AY069556

> LD28566.complete
CTTAAACGCAGACCAGAAATATTTTGCAAAGGACGTCAAGGAATGCTGAG
AAGGATGAACACTTTTAGTGGTCAAAAGCTGGCGGCTGTGGTCAAGGAGC
TGGAGAACTTTGCTCCGACTTCTTGGGCAGAGAAGTGGGACAATGTGGGA
CTCCTGATCGAACCGCACCGCGAAAAACAAATCAAGAAAATACTATTAAC
TAACGATTTAACCGAGCCCGTAGTGAAAGAAGCGCTAGAGAAGGAGGCGG
AGCTCATAATCAGCTATCATCCGCCAATTTTCAAGCCCCTGACCAGGATT
ACGCAGTCACATTGGAAGGAGCGCGTGGTGGCAGCATGCTTGGCCAACGA
TATAGCCTTGTACTCGCCCCACACGGCGTGGGATAAGAAGAGTGGTGGCG
TCAACGACTGGCTATCTAAGGCAGTGAATATCATCAGCATCCGCCCTCTG
GAACCGGAGTTGGGTGCTCCTCCGGGTACCGGATCCGGTAGATATATAGA
AACCAAAATGGAGCTTTCCCAGGTGGTGGAGTCTCTGCAAAAGCGCATTA
GAAACAGCGTGCACGTTGCTCTAGCTGTGGGCCACACCCCCAAGACACTC
ATCCAATCCGTCGGCATTTGTGCCGGCTCTGGAGCATCTCTGCTGAAGGG
TATCCAAGCGGATCTTATCATTACCGGCGAAATGTCCCATCACGAAGTTC
TGGAGTTTACTCACAACAATACCACCGTTCTTCTCTGCAATCATAGTAAT
TCAGAAAGGGGTTTTCTCCATGAGTTTTGCCCTATATTGGCCAAATCTTT
AAATGAAGAATGCCTGGTATTTGTATCTGAAGTGGACAAGGATCCTCTGG
TCACCGTGGCTAGCGATATAAACAAAGAACTAAGCGCATTTGTTGACGTC
TACAAGAGCACATCAAAATAACTTTGATCTTATAAGCATTTTTTGTTTAA
CAATGCATTTTCTGGCGCATCCATAAAGGTTACAAATAAACTAAAGGATT
TAACTTTCTTAACTTCTAAAAAAAAAAAAAAAAAA

LD28566.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG4278-RA 1061 CG4278-RA 44..1061 1..1017 5050 99.9 Plus
mRpL4-RA 1140 mRpL4-RA 1019..1140 1018..897 610 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:37:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 16325977..16326994 1..1017 5040 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:21:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:37:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16327114..16328132 1..1018 5045 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 16327114..16328132 1..1018 5055 99.9 Plus
Blast to na_te.dros performed on 2019-03-15 13:37:47 has no hits.

LD28566.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:38:36 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 16325977..16326994 1..1017 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:19 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 1..879 43..921 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:43:14 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 1..879 43..921 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:07:47 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 1..879 43..921 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:22:18 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 1..879 43..921 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:36:27 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 1..879 43..921 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:41 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 44..1061 1..1017 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:43:14 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 44..1061 1..1017 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:07:47 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 46..1063 1..1017 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:22:18 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 44..1061 1..1017 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:36:27 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
CG4278-RA 46..1063 1..1017 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:36 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16327114..16328131 1..1017 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:36 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16327114..16328131 1..1017 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:38:36 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16327114..16328131 1..1017 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:07:47 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 16327114..16328131 1..1017 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:55 Download gff for LD28566.complete
Subject Subject Range Query Range Percent Splice Strand
2L 16327114..16328131 1..1017 99   Plus

LD28566.hyp Sequence

Translation from 0 to 920

> LD28566.hyp
LNAGPEIFCKGRQGMLRRMNTFSGQKLAAVVKELENFAPTSWAEKWDNVG
LLIEPHREKQIKKILLTNDLTEPVVKEALEKEAELIISYHPPIFKPLTRI
TQSHWKERVVAACLANDIALYSPHTAWDKKSGGVNDWLSKAVNIISIRPL
EPELGAPPGTGSGRYIETKMELSQVVESLQKRIRNSVHVALAVGHTPKTL
IQSVGICAGSGASLLKGIQADLIITGEMSHHEVLEFTHNNTTVLLCNHSN
SERGFLHEFCPILAKSLNEECLVFVSEVDKDPLVTVASDINKELSAFVDV
YKSTSK*

LD28566.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4278-PA 292 CG4278-PA 1..292 15..306 1505 100 Plus

LD28566.pep Sequence

Translation from 42 to 920

> LD28566.pep
MLRRMNTFSGQKLAAVVKELENFAPTSWAEKWDNVGLLIEPHREKQIKKI
LLTNDLTEPVVKEALEKEAELIISYHPPIFKPLTRITQSHWKERVVAACL
ANDIALYSPHTAWDKKSGGVNDWLSKAVNIISIRPLEPELGAPPGTGSGR
YIETKMELSQVVESLQKRIRNSVHVALAVGHTPKTLIQSVGICAGSGASL
LKGIQADLIITGEMSHHEVLEFTHNNTTVLLCNHSNSERGFLHEFCPILA
KSLNEECLVFVSEVDKDPLVTVASDINKELSAFVDVYKSTSK*

LD28566.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14582-PA 283 GF14582-PA 1..270 5..274 1168 80.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25205-PA 289 GG25205-PA 1..288 1..288 1408 90.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:24:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10316-PA 273 GH10316-PA 7..268 10..271 942 65.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG4278-PA 292 CG4278-PA 1..292 1..292 1505 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17077-PA 281 GI17077-PA 1..267 5..271 992 70.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:25:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16352-PA 283 GL16352-PA 1..268 5..271 1081 74.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:25:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18076-PA 283 GA18076-PA 1..268 5..271 1080 74.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18668-PA 289 GM18668-PA 1..288 1..288 1506 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:25:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24053-PA 289 GD24053-PA 1..288 1..288 1523 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10651-PA 281 GJ10651-PA 1..268 5..272 1037 71.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:25:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24701-PA 285 GK24701-PA 3..268 12..272 991 69.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:25:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21475-PA 289 GE21475-PA 1..288 1..288 1452 93.1 Plus