Clone LD28808 Report

Search the DGRC for LD28808

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:288
Well:8
Vector:pOT2
Associated Gene/TranscriptArt1-RA
Protein status:LD28808.pep: gold
Preliminary Size:1668
Sequenced Size:1511

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6554 2001-01-01 Release 2 assignment
CG6554 2002-04-04 Blastp of sequenced clone
CG6554 2003-01-01 Sim4 clustering to Release 3
Art1 2008-04-29 Release 5.5 accounting
Art1 2008-08-15 Release 5.9 accounting
Art1 2008-12-18 5.12 accounting

Clone Sequence Records

LD28808.complete Sequence

1511 bp (1511 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095041

> LD28808.complete
TAGAAACAGTCCCATCATTTAGTCGCCAATTTTTCGACGTGAAAAACCAA
AGAGACGCCGAAGAAATTAGAAAATGGCCAGCACAGACATTCCCATGGAG
GCAGCTGTGGAATCGGCGACCGGCATCACGCCCAATTCAAATGCGAACTC
AAACAATGTGGCGAAGAAGCTGCCCGCGGAGGGCTCCACCGGTGATAATC
CCAATGCCAACGCCGACGAGATGACGTCCCGCGACTATTACTTTGACTCC
TATGCCCATTTCGGGATCCACGAGGAGATGCTCAAGGACGAAGTGCGCAC
CGTCACATACCGCAACGCCATGTACCACAACAAGCATCTGTTTCAGGGCA
AGACCGTACTGGACGTGGGTTGCGGTACCGGCATTCTCTCCATGTTCGCT
GCCAAAGCCGGTGCTGCTCAGGTGATTGCCGTCGACTGCTCCAACATCAT
TGAGTTTGCCCGCCAAGTGGTCATTGACAACAATCTGCAGGATGTAATCA
CGGTTGTCAAGGGCAAGATTGAGGAGATTGAGCTTCCAAATGGTATTGAG
GGAGTGGACATTATTATTTCCGAGTGGATGGGTTACTGCCTGTTCTACGA
ATCCATGCTGGATACAGTGTTGTACGCTCGGGACAAGTGGCTGAAGAAGG
ACGGCATGATGTTCCCAGATAGGGGCACGCTGTATATCACGGCCATCGAG
GACAGACAGTACAAGGACGAGAAGATCAACTGGTGGGACGATGTCTACGG
CTTCGACATGAGCTGCATTCGTAAGGTGGCCGTGACCGAGCCACTGGTCG
ACGTGGTCGATCCCAAGCAAGTGGTATCCACATCTTGCATGGTCAAGGAG
GTGGATCTGTATACCGTGCAAAAGGCCGATCTTAACTTCTCGTCCAAGTT
CAGCCTATGCATCAAGCGCAACGACTTCGTGCAGGCATTAGTCACCTACT
TTAATATAGAGTTCACCAAGTGCCACAAGCGTCTTGGGTTCAGTACGTCA
CCAGACTCCACATACACGCATTGGAAGCAAACCGTGTTCTACCTCGATGA
CCACATGACGGCAAAGAAGAACGAGGAGATCACTGGCACGTTCCAGATGA
AGCCCAACGAGCGGAACAACCGTGACCTGGACTTCGTCATCGACATTAAT
TTCAAGGGCGAATTGTCTCAAATTCAGGAGTCGAACACATACCGCATGCG
CTAGGGGCAGCCATAACCAATCCGATCTGCCATTTGGGATGGGGCTCAGA
GCCCTGCAGCGAGGATACATACAATGACTAGACGTAAGGTTTATTCCAGT
GCGAAATGTGCAACGAATTCGTGTTGCGTCTTCTCCTAAGTTTAAAGTGT
ACCTTTGTTAGTATACATAATATTTTACACTCGTGCGCCTGTTTAAATTA
TTATTCGAACATACTTCTAAGCAAGTTGTACAGCAGCACGTCAATTCTCA
CATAATAAACAGTGCACTAAGCACGTCCCCTTTTGCTGGAAAAAAAAAAA
AAAAAAAAAAA

LD28808.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
Art1-RA 1681 Art1-RA 186..1681 1..1496 7465 99.9 Plus
Art1.a 1634 Art1.a 139..1634 1..1496 7465 99.9 Plus
Art1.b 1234 Art1.b 97..1234 352..1489 5690 100 Plus
Art1.b 1234 Art1.b 22..97 1..76 380 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 6611999..6612906 1489..582 4525 99.9 Minus
chr3R 27901430 chr3R 6613291..6613567 352..76 1385 100 Minus
chr3R 27901430 chr3R 6612993..6613224 582..351 1130 99.1 Minus
chr3R 27901430 chr3R 6613629..6613705 77..1 370 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:21:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:53:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10786474..10787388 1496..582 4560 99.9 Minus
3R 32079331 3R 10787773..10788049 352..76 1385 100 Minus
3R 32079331 3R 10787475..10787706 582..351 1160 100 Minus
3R 32079331 3R 10788111..10788187 77..1 385 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:47:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10527305..10528219 1496..582 4560 99.8 Minus
3R 31820162 3R 10528604..10528880 352..76 1385 100 Minus
3R 31820162 3R 10528306..10528537 582..351 1160 100 Minus
3R 31820162 3R 10528942..10529018 77..1 385 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:53:26 has no hits.

LD28808.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:54:05 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 6611999..6612905 583..1489 99 <- Minus
chr3R 6612993..6613222 353..582 99 <- Minus
chr3R 6613291..6613566 77..352 100 <- Minus
chr3R 6613630..6613705 1..76 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:36 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 1..1131 74..1204 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:17:30 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 1..1131 74..1204 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:17:36 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 1..1131 74..1204 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:57:50 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 1..1131 74..1204 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:22 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 1..1131 74..1204 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:47:11 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 22..1510 1..1489 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:17:30 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 22..1510 1..1489 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:17:36 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 40..1528 1..1489 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:57:50 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 22..1510 1..1489 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:22 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
Art1-RA 40..1528 1..1489 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:54:05 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10786481..10787387 583..1489 100 <- Minus
3R 10787475..10787704 353..582 100 <- Minus
3R 10787773..10788048 77..352 100 <- Minus
3R 10788112..10788187 1..76 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:54:05 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10786481..10787387 583..1489 100 <- Minus
3R 10787475..10787704 353..582 100 <- Minus
3R 10787773..10788048 77..352 100 <- Minus
3R 10788112..10788187 1..76 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:54:05 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10786481..10787387 583..1489 100 <- Minus
3R 10787475..10787704 353..582 100 <- Minus
3R 10787773..10788048 77..352 100 <- Minus
3R 10788112..10788187 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:17:36 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6612203..6613109 583..1489 100 <- Minus
arm_3R 6613197..6613426 353..582 100 <- Minus
arm_3R 6613495..6613770 77..352 100 <- Minus
arm_3R 6613834..6613909 1..76 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:30:21 Download gff for LD28808.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10527312..10528218 583..1489 100 <- Minus
3R 10528306..10528535 353..582 100 <- Minus
3R 10528604..10528879 77..352 100 <- Minus
3R 10528943..10529018 1..76 100   Minus

LD28808.pep Sequence

Translation from 73 to 1203

> LD28808.pep
MASTDIPMEAAVESATGITPNSNANSNNVAKKLPAEGSTGDNPNANADEM
TSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGC
GTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIE
EIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDR
GTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQV
VSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTKC
HKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNR
DLDFVIDINFKGELSQIQESNTYRMR*

LD28808.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17088-PA 372 GF17088-PA 1..372 8..376 1816 91.8 Plus
Dana\GF14882-PA 369 GF14882-PA 39..360 48..373 766 43.9 Plus
Dana\GF18899-PA 348 GF18899-PA 27..340 56..368 692 41 Plus
Dana\GF11802-PA 520 GF11802-PA 204..510 41..358 644 42.1 Plus
Dana\GF10317-PA 511 GF10317-PA 119..448 4..344 566 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:39:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17264-PA 397 GG17264-PA 23..397 2..376 2019 99.2 Plus
Dere\GG24386-PA 355 GG24386-PA 17..336 41..363 780 46 Plus
Dere\GG17013-PA 345 GG17013-PA 23..336 56..368 735 41.6 Plus
Dere\GG20792-PA 517 GG20792-PA 188..507 35..358 659 41 Plus
Dere\GG17314-PA 530 GG17314-PA 137..465 49..376 539 38 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19565-PA 382 GH19565-PA 1..382 8..376 1775 87.4 Plus
Dgri\GH18753-PA 507 GH18753-PA 181..499 37..362 656 41.4 Plus
Dgri\GH16647-PA 336 GH16647-PA 20..332 58..376 592 37.5 Plus
Dgri\GH14177-PA 544 GH14177-PA 146..474 49..376 531 37.7 Plus
Dgri\GH15628-PA 407 GH15628-PA 35..334 46..343 477 33.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:15:38
Subject Length Description Subject Range Query Range Score Percent Strand
Art1-PA 376 CG6554-PA 1..376 1..376 1981 100 Plus
Art2-PB 355 CG3675-PB 10..335 36..362 768 46.4 Plus
Art2-PA 355 CG3675-PA 10..335 36..362 768 46.4 Plus
Art6-PA 341 CG9927-PA 19..337 56..373 705 40.6 Plus
Art3-PB 474 CG6563-PB 140..464 31..358 636 40.4 Plus
Art3-PA 516 CG6563-PA 182..506 31..358 636 40.4 Plus
Art4-PB 530 CG5358-PB 137..465 49..376 514 38 Plus
Art4-PA 530 CG5358-PA 137..465 49..376 514 38 Plus
CG32152-PC 357 CG32152-PC 1..305 50..352 512 33.4 Plus
CG32152-PB 357 CG32152-PB 1..305 50..352 512 33.4 Plus
Art8-PA 341 CG16840-PA 5..309 56..358 459 36.3 Plus
Art9-PA 313 CG9929-PA 13..303 67..354 387 32.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23860-PA 387 GI23860-PA 5..387 10..376 1764 86.3 Plus
Dmoj\GI24669-PA 431 GI24669-PA 124..425 56..364 686 43.4 Plus
Dmoj\GI11605-PA 338 GI11605-PA 23..332 59..376 598 37.5 Plus
Dmoj\GI12675-PA 632 GI12675-PA 269..581 32..344 573 34.6 Plus
Dmoj\GI22087-PA 539 GI22087-PA 145..473 49..376 530 37.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21930-PA 392 GL21930-PA 18..392 2..376 1839 89.6 Plus
Dper\GL16439-PA 366 GL16439-PA 28..355 53..373 728 42.1 Plus
Dper\GL23322-PA 351 GL23322-PA 9..341 38..369 697 39.5 Plus
Dper\GL12077-PA 514 GL12077-PA 206..504 56..358 632 42.2 Plus
Dper\GL27288-PA 531 GL27288-PA 137..465 49..376 533 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19682-PA 392 GA19682-PA 18..392 2..376 1839 89.6 Plus
Dpse\GA17605-PA 366 GA17605-PA 16..355 40..373 732 41.9 Plus
Dpse\GA27221-PA 351 GA27221-PA 15..338 44..366 690 40 Plus
Dpse\GA19687-PA 514 GA19687-PA 206..504 56..358 631 42.2 Plus
Dpse\GA19687-PB 481 GA19687-PB 149..471 36..358 630 40.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26148-PA 397 GM26148-PA 23..397 2..376 2000 98.7 Plus
Dsec\GM18100-PA 355 GM18100-PA 15..336 41..363 788 46.6 Plus
Dsec\GM25897-PA 444 GM25897-PA 87..440 7..373 747 38.6 Plus
Dsec\GM25795-PA 516 GM25795-PA 180..506 29..358 678 41.7 Plus
Dsec\GM26200-PA 530 GM26200-PA 137..465 49..376 537 38 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20702-PA 397 GD20702-PA 23..397 2..376 2021 99.2 Plus
Dsim\GD22717-PA 355 GD22717-PA 15..336 41..363 795 46.6 Plus
Dsim\GD20467-PA 341 GD20467-PA 19..337 56..373 742 40.9 Plus
Dsim\GD20372-PA 477 GD20372-PA 141..467 29..358 677 41.7 Plus
Dsim\GD20747-PA 530 GD20747-PA 137..465 49..376 537 38 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10573-PA 381 GJ10573-PA 1..381 8..376 1787 87.7 Plus
Dvir\GJ24043-PA 508 GJ24043-PA 201..497 56..357 666 43.9 Plus
Dvir\GJ11284-PA 311 GJ11284-PA 1..305 70..376 567 36.9 Plus
Dvir\GJ24202-PA 538 GJ24202-PA 144..472 49..376 530 37.7 Plus
Dvir\GJ12659-PA 473 GJ12659-PA 115..434 31..360 517 33.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13389-PA 382 GK13389-PA 12..382 15..376 1775 88.7 Plus
Dwil\GK24448-PA 383 GK24448-PA 54..372 56..373 871 49.2 Plus
Dwil\GK22483-PA 344 GK22483-PA 17..331 56..368 746 43.7 Plus
Dwil\GK12781-PA 517 GK12781-PA 209..513 56..366 643 42.8 Plus
Dwil\GK17166-PA 331 GK17166-PA 13..309 60..363 578 40 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:39:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24666-PA 378 GE24666-PA 1..378 1..376 2019 99.2 Plus
Dyak\GE24405-PA 345 GE24405-PA 23..341 56..373 748 41.9 Plus
Dyak\GE14754-PA 355 GE14754-PA 15..335 41..362 739 45.2 Plus
Dyak\GE26400-PA 516 GE26400-PA 188..506 36..358 652 40.9 Plus
Dyak\GE24716-PA 530 GE24716-PA 137..465 49..376 538 38 Plus

LD28808.hyp Sequence

Translation from 73 to 1203

> LD28808.hyp
MASTDIPMEAAVESATGITPNSNANSNNVAKKLPAEGSTGDNPNANADEM
TSRDYYFDSYAHFGIHEEMLKDEVRTVTYRNAMYHNKHLFQGKTVLDVGC
GTGILSMFAAKAGAAQVIAVDCSNIIEFARQVVIDNNLQDVITVVKGKIE
EIELPNGIEGVDIIISEWMGYCLFYESMLDTVLYARDKWLKKDGMMFPDR
GTLYITAIEDRQYKDEKINWWDDVYGFDMSCIRKVAVTEPLVDVVDPKQV
VSTSCMVKEVDLYTVQKADLNFSSKFSLCIKRNDFVQALVTYFNIEFTKC
HKRLGFSTSPDSTYTHWKQTVFYLDDHMTAKKNEEITGTFQMKPNERNNR
DLDFVIDINFKGELSQIQESNTYRMR*

LD28808.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:21:50
Subject Length Description Subject Range Query Range Score Percent Strand
Art1-PA 376 CG6554-PA 1..376 1..376 1981 100 Plus
Art2-PB 355 CG3675-PB 10..335 36..362 768 46.4 Plus
Art2-PA 355 CG3675-PA 10..335 36..362 768 46.4 Plus
Art6-PA 341 CG9927-PA 19..337 56..373 705 40.6 Plus
Art3-PB 474 CG6563-PB 140..464 31..358 636 40.4 Plus