Clone LD28985 Report

Search the DGRC for LD28985

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:289
Well:85
Vector:pOT2
Associated Gene/TranscriptCG8386-RA
Protein status:LD28985.pep: gold
Preliminary Size:839
Sequenced Size:639

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8386 2001-01-01 Release 2 assignment
CG8386 2001-10-10 Blastp of sequenced clone
CG8386 2003-01-01 Sim4 clustering to Release 3
CG8386 2008-04-29 Release 5.5 accounting
CG8386 2008-08-15 Release 5.9 accounting
CG8386 2008-12-18 5.12 accounting

Clone Sequence Records

LD28985.complete Sequence

639 bp (639 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061366

> LD28985.complete
TGTCAAGCGAAGGCTTTTGTTTTCGTTCCGCATTTTCCTTACTTTTGGCT
ATTTTCCGGACGAGATGGTGGACGACAGCACTCGAAAAACGTTGAGCAAC
ATTCCGCTGCTGCAGATTCGCGCTGGTCCGCGCGAAAAGGATGTGTGGGT
GCAGCGGCTCAAGGAGGAGTACCAGGCACTAATTAAGTATGTGGAGAACA
ACAAACAGTCCGGCAGCGACTGGTTCCGTCTGGAATCCAACAAGGAGGGC
ACCAAGTGGTTCGGAAAGTGTTGGTACATGCACAACCTGTTAAAGTACGA
GTTCGACGTGGAGTTCGACATTCCAGTGACGTACCCAACCACCGCGCCCG
AGATTGCCCTGCCAGAACTTGACGGCAAGACAGCGAAGATGTACCGTGGT
GGCAAGATCTGTCTGACGGATCACTTTAAGCCACTGTGGGCACGCAATGT
TCCCAAGTTTGGGATCGCCCACGCTATGGCTCTGGGTCTTGCTCCCTGGC
TGGCCGTGGAGATTCCGGATCTCATCGAGAAGGGAATCATTACGTACAAG
GAAAAGTAGCTAACTCAACTAGATAAAATTACTGGCAACAAAACAATGAA
CAAAGTTTGATACGAAAGTCAAAAAAAAAAAAAAAAAAA

LD28985.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-RA 791 CG8386-RA 162..783 1..622 3110 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11894356..11894657 487..186 1510 100 Minus
chr2R 21145070 chr2R 11894714..11894900 187..1 935 100 Minus
chr2R 21145070 chr2R 11894162..11894294 620..488 665 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:21:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16007087..16007388 487..186 1510 100 Minus
2R 25286936 2R 16007445..16007631 187..1 935 100 Minus
2R 25286936 2R 16006891..16007025 622..488 675 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16008286..16008587 487..186 1510 100 Minus
2R 25260384 2R 16008644..16008830 187..1 935 100 Minus
2R 25260384 2R 16008090..16008224 622..488 675 100 Minus
Blast to na_te.dros performed 2019-03-16 05:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsil\Loa 7779 Dsil\Loa DSV28T24 7779bp AKA(S39346) Derived from X60177 (Rel. 37, Last updated, Version 8). 5679..5735 58..114 114 66.7 Plus

LD28985.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:15:19 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11894162..11894294 488..620 100 <- Minus
chr2R 11894356..11894655 188..487 100 <- Minus
chr2R 11894714..11894900 1..187 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:53 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 1..495 65..559 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:28:15 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 1..495 65..559 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:08:27 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 1..495 65..559 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:18:41 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 1..495 65..559 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:00:20 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 1..495 65..559 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:57:08 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 25..644 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:28:14 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 25..644 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:08:27 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 37..656 1..620 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:18:42 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 25..644 1..620 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:00:20 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
CG8386-RA 37..656 1..620 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:19 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16006893..16007025 488..620 100 <- Minus
2R 16007087..16007386 188..487 100 <- Minus
2R 16007445..16007631 1..187 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:19 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16006893..16007025 488..620 100 <- Minus
2R 16007087..16007386 188..487 100 <- Minus
2R 16007445..16007631 1..187 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:19 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16006893..16007025 488..620 100 <- Minus
2R 16007087..16007386 188..487 100 <- Minus
2R 16007445..16007631 1..187 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:08:27 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11894398..11894530 488..620 100 <- Minus
arm_2R 11894592..11894891 188..487 100 <- Minus
arm_2R 11894950..11895136 1..187 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:52:08 Download gff for LD28985.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16008286..16008585 188..487 100 <- Minus
2R 16008644..16008830 1..187 100   Minus
2R 16008092..16008224 488..620 100 <- Minus

LD28985.hyp Sequence

Translation from 0 to 558

> LD28985.hyp
VKRRLLFSFRIFLTFGYFPDEMVDDSTRKTLSNIPLLQIRAGPREKDVWV
QRLKEEYQALIKYVENNKQSGSDWFRLESNKEGTKWFGKCWYMHNLLKYE
FDVEFDIPVTYPTTAPEIALPELDGKTAKMYRGGKICLTDHFKPLWARNV
PKFGIAHAMALGLAPWLAVEIPDLIEKGIITYKEK*

LD28985.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG8386-PA 164 CG8386-PA 1..164 22..185 887 100 Plus

LD28985.pep Sequence

Translation from 64 to 558

> LD28985.pep
MVDDSTRKTLSNIPLLQIRAGPREKDVWVQRLKEEYQALIKYVENNKQSG
SDWFRLESNKEGTKWFGKCWYMHNLLKYEFDVEFDIPVTYPTTAPEIALP
ELDGKTAKMYRGGKICLTDHFKPLWARNVPKFGIAHAMALGLAPWLAVEI
PDLIEKGIITYKEK*

LD28985.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 06:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13328-PA 164 GF13328-PA 1..164 1..164 864 98.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 06:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22310-PA 164 GG22310-PA 1..164 1..164 876 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 06:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19828-PA 168 GH19828-PA 1..166 1..163 842 94.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Ufc1-PA 164 CG8386-PA 1..164 1..164 887 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 06:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20416-PA 165 GI20416-PA 1..163 1..163 866 98.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 06:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10211-PA 164 GL10211-PA 1..164 1..164 860 97.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 06:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21037-PA 164 GA21037-PA 1..164 1..164 860 97.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 06:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20100-PA 164 GM20100-PA 1..164 1..164 872 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 06:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25576-PA 164 GD25576-PA 1..164 1..164 872 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 06:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20088-PA 165 GJ20088-PA 1..163 1..163 865 98.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 06:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10642-PA 164 GK10642-PA 1..164 1..164 857 96.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 06:47:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14107-PA 164 GE14107-PA 1..164 1..164 876 100 Plus