LD29015.complete Sequence
659 bp (659 high quality bases) assembled on 2002-06-05
GenBank Submission: AY119605
> LD29015.complete
ATGCACTTTAGTATAACAAATTCTCGCCAAGATATGAAGCCGTATTTAGA
TTCAGATTATTCCATCAGTCGCAATTTGCGTCAGAGACATAGAAAAAAAG
GAGTTTCTAACGAATACTCAAATTATTTAGATTCCGAAAATAAAAAAAAA
GGCAGAAAGAAATGTCAAAATAGCGCATATGATGAATACGGAAATATTCG
CTCAAACGGTCTGGACATATGCGACTGTATGAATCAAGAATGTGATGGTT
GCTGGTATAATTGCCGAAGTTGTGGCTCTACCAGGTGTGGTCCCCAATGT
CGCTCGAATCGAAAGTTTTTTTATGAGGACATAACATATGACGGTAAAGA
TTTAAATATTCAAAATAAATATATACCAAGATAAAGTTAAGCAAATCACA
TGTATTAATTAAATATTTGTAACTTAATATAAGTATTAATGAACAGCCAA
ACGAGCATTAAACTATCATTCAGACGAAATACATCACATATAACAATTCT
TAACAAAGTTATTGCTTCAGAAAAATACATTATGTGCTAATTGAAAGGAA
ATGATTCCAAAAATAAAGTAAATTCTTCAGCAGCTATGGTGAAGACTTAT
TGTACTTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA
LD29015.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:54:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14464.e | 1110 | CG14464.e | 59..668 | 1..610 | 3050 | 100 | Plus |
CG14464.a | 714 | CG14464.a | 59..668 | 1..610 | 3050 | 100 | Plus |
CG14464.b | 1319 | CG14464.b | 59..668 | 1..610 | 3050 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:26:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 717117..717505 | 221..609 | 1945 | 100 | Plus |
chr2R | 21145070 | chr2R | 716844..717064 | 1..221 | 1105 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:21:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 4829547..4829936 | 221..610 | 1950 | 100 | Plus |
2R | 25286936 | 2R | 4829274..4829494 | 1..221 | 1105 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 4830746..4831135 | 221..610 | 1950 | 100 | Plus |
2R | 25260384 | 2R | 4830473..4830693 | 1..221 | 1105 | 100 | Plus |
Blast to na_te.dros performed 2019-03-15 22:25:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Max-element | 8556 | Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). | 976..1101 | 325..445 | 133 | 61.2 | Plus |
412 | 7567 | 412 412 7567bp | 1172..1245 | 355..430 | 130 | 70.1 | Plus |
LD29015.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:26:42 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 716844..717063 | 1..220 | 100 | -> | Plus |
chr2R | 717117..717505 | 221..609 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:58 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 1..351 | 34..384 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:26 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 1..351 | 34..384 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:19:42 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 1..351 | 34..384 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:39 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 1..351 | 34..384 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:28 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 1..351 | 34..384 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:01:43 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 55..663 | 1..609 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:25 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 55..663 | 1..609 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:19:42 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 29..637 | 1..609 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:39 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 55..663 | 1..609 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:28 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14464-RC | 29..637 | 1..609 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:42 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4829274..4829493 | 1..220 | 100 | -> | Plus |
2R | 4829547..4829935 | 221..609 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:42 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4829274..4829493 | 1..220 | 100 | -> | Plus |
2R | 4829547..4829935 | 221..609 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:42 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4829274..4829493 | 1..220 | 100 | -> | Plus |
2R | 4829547..4829935 | 221..609 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:19:42 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 716779..716998 | 1..220 | 100 | -> | Plus |
arm_2R | 717052..717440 | 221..609 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:23 Download gff for
LD29015.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 4830473..4830692 | 1..220 | 100 | -> | Plus |
2R | 4830746..4831134 | 221..609 | 100 | | Plus |
LD29015.pep Sequence
Translation from 0 to 383
> LD29015.pep
MHFSITNSRQDMKPYLDSDYSISRNLRQRHRKKGVSNEYSNYLDSENKKK
GRKKCQNSAYDEYGNIRSNGLDICDCMNQECDGCWYNCRSCGSTRCGPQC
RSNRKFFYEDITYDGKDLNIQNKYIPR*
LD29015.pep Blast Records
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:59:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH11310-PA | 112 | GH11310-PA | 3..109 | 23..126 | 317 | 58.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14464-PD | 116 | CG14464-PD | 1..116 | 12..127 | 659 | 100 | Plus |
CG14464-PC | 116 | CG14464-PC | 1..116 | 12..127 | 659 | 100 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:59:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ17647-PA | 114 | GJ17647-PA | 3..111 | 23..126 | 345 | 62.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:59:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK10756-PA | 582 | GK10756-PA | 5..90 | 16..96 | 148 | 44.8 | Plus |
LD29015.hyp Sequence
Translation from 1 to 383
> LD29015.hyp
MHFSITNSRQDMKPYLDSDYSISRNLRQRHRKKGVSNEYSNYLDSENKKK
GRKKCQNSAYDEYGNIRSNGLDICDCMNQECDGCWYNCRSCGSTRCGPQC
RSNRKFFYEDITYDGKDLNIQNKYIPR*
LD29015.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:23:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14464-PD | 116 | CG14464-PD | 1..116 | 12..127 | 659 | 100 | Plus |
CG14464-PC | 116 | CG14464-PC | 1..116 | 12..127 | 659 | 100 | Plus |