Clone LD29015 Report

Search the DGRC for LD29015

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:290
Well:15
Vector:pOT2
Associated Gene/TranscriptCG14464-RC
Protein status:LD29015.pep: gold
Preliminary Size:906
Sequenced Size:659

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14464 2002-01-01 Sim4 clustering to Release 2
CG40285 2002-06-05 Blastp of sequenced clone
CG14464 2008-04-29 Release 5.5 accounting
CG14464 2008-08-15 Release 5.9 accounting
CG14464 2008-12-18 5.12 accounting

Clone Sequence Records

LD29015.complete Sequence

659 bp (659 high quality bases) assembled on 2002-06-05

GenBank Submission: AY119605

> LD29015.complete
ATGCACTTTAGTATAACAAATTCTCGCCAAGATATGAAGCCGTATTTAGA
TTCAGATTATTCCATCAGTCGCAATTTGCGTCAGAGACATAGAAAAAAAG
GAGTTTCTAACGAATACTCAAATTATTTAGATTCCGAAAATAAAAAAAAA
GGCAGAAAGAAATGTCAAAATAGCGCATATGATGAATACGGAAATATTCG
CTCAAACGGTCTGGACATATGCGACTGTATGAATCAAGAATGTGATGGTT
GCTGGTATAATTGCCGAAGTTGTGGCTCTACCAGGTGTGGTCCCCAATGT
CGCTCGAATCGAAAGTTTTTTTATGAGGACATAACATATGACGGTAAAGA
TTTAAATATTCAAAATAAATATATACCAAGATAAAGTTAAGCAAATCACA
TGTATTAATTAAATATTTGTAACTTAATATAAGTATTAATGAACAGCCAA
ACGAGCATTAAACTATCATTCAGACGAAATACATCACATATAACAATTCT
TAACAAAGTTATTGCTTCAGAAAAATACATTATGTGCTAATTGAAAGGAA
ATGATTCCAAAAATAAAGTAAATTCTTCAGCAGCTATGGTGAAGACTTAT
TGTACTTGTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

LD29015.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG14464.e 1110 CG14464.e 59..668 1..610 3050 100 Plus
CG14464.a 714 CG14464.a 59..668 1..610 3050 100 Plus
CG14464.b 1319 CG14464.b 59..668 1..610 3050 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:26:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 717117..717505 221..609 1945 100 Plus
chr2R 21145070 chr2R 716844..717064 1..221 1105 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:21:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 4829547..4829936 221..610 1950 100 Plus
2R 25286936 2R 4829274..4829494 1..221 1105 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:26:29
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 4830746..4831135 221..610 1950 100 Plus
2R 25260384 2R 4830473..4830693 1..221 1105 100 Plus
Blast to na_te.dros performed 2019-03-15 22:25:58
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 976..1101 325..445 133 61.2 Plus
412 7567 412 412 7567bp 1172..1245 355..430 130 70.1 Plus

LD29015.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:26:42 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 716844..717063 1..220 100 -> Plus
chr2R 717117..717505 221..609 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:08:58 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 1..351 34..384 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:31:26 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 1..351 34..384 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:19:42 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 1..351 34..384 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:21:39 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 1..351 34..384 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:28 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 1..351 34..384 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:01:43 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 55..663 1..609 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:31:25 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 55..663 1..609 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:19:42 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 29..637 1..609 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:21:39 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 55..663 1..609 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:28 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
CG14464-RC 29..637 1..609 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:42 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4829274..4829493 1..220 100 -> Plus
2R 4829547..4829935 221..609 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:42 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4829274..4829493 1..220 100 -> Plus
2R 4829547..4829935 221..609 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:26:42 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4829274..4829493 1..220 100 -> Plus
2R 4829547..4829935 221..609 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:19:42 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 716779..716998 1..220 100 -> Plus
arm_2R 717052..717440 221..609 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:55:23 Download gff for LD29015.complete
Subject Subject Range Query Range Percent Splice Strand
2R 4830473..4830692 1..220 100 -> Plus
2R 4830746..4831134 221..609 100   Plus

LD29015.pep Sequence

Translation from 0 to 383

> LD29015.pep
MHFSITNSRQDMKPYLDSDYSISRNLRQRHRKKGVSNEYSNYLDSENKKK
GRKKCQNSAYDEYGNIRSNGLDICDCMNQECDGCWYNCRSCGSTRCGPQC
RSNRKFFYEDITYDGKDLNIQNKYIPR*

LD29015.pep Blast Records

Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 07:59:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11310-PA 112 GH11310-PA 3..109 23..126 317 58.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG14464-PD 116 CG14464-PD 1..116 12..127 659 100 Plus
CG14464-PC 116 CG14464-PC 1..116 12..127 659 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 07:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17647-PA 114 GJ17647-PA 3..111 23..126 345 62.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 07:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10756-PA 582 GK10756-PA 5..90 16..96 148 44.8 Plus

LD29015.hyp Sequence

Translation from 1 to 383

> LD29015.hyp
MHFSITNSRQDMKPYLDSDYSISRNLRQRHRKKGVSNEYSNYLDSENKKK
GRKKCQNSAYDEYGNIRSNGLDICDCMNQECDGCWYNCRSCGSTRCGPQC
RSNRKFFYEDITYDGKDLNIQNKYIPR*

LD29015.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG14464-PD 116 CG14464-PD 1..116 12..127 659 100 Plus
CG14464-PC 116 CG14464-PC 1..116 12..127 659 100 Plus