Clone LD29166 Report

Search the DGRC for LD29166

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:291
Well:66
Vector:pOT2
Associated Gene/TranscriptCG7407-RA
Protein status:LD29166.pep: gold
Preliminary Size:1215
Sequenced Size:1010

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7407 2001-01-01 Release 2 assignment
CG7407 2003-01-01 Sim4 clustering to Release 3
CG7407 2003-01-14 Blastp of sequenced clone
CG7407 2008-04-29 Release 5.5 accounting
CG7407 2008-08-15 Release 5.9 accounting
CG7407 2008-12-18 5.12 accounting

Clone Sequence Records

LD29166.complete Sequence

1010 bp (1010 high quality bases) assembled on 2003-01-14

GenBank Submission: AY061368

> LD29166.complete
AAAAGAGTTCGAAATGCAGGATTTTCTGCCTTCGCTGGATGTTCTCTTTC
TTGGACTACCAGGCCACTACTCGGTAGCGCTGGTCACCCTTCTGCTGTGC
GTTTTGGTCGCCTTCTACTTCGCCAACATCTTCAAGGACAAAGGCGAACT
GGAGGACGAGGGCCTGGGGGCCGACGAGCCGCGCGATGAGGAGGATTCCG
AGTCACGGACTCCGCAAGGGGAGGAAACCGACGATGACGAGGCCTACGAA
GAGAACTCCACCGAAAGCGAAGTTGAGCTAATCGAGGAACAGCTGCCCGA
GCACAGCTACAACCACCTGATGGGCCAGCTCAAGGCCAAGAGGCTCCAGC
ATAAGATGGAGAAGACCCTGACTCCCAGCCAAATCGAGGAGGAGCGCCGA
ATAGAGCGCGAGCAGCTGGCGGCCATCTTTGAGCTCCTGCGCAAACAGGA
GGCGGAATTGAACCTCCAGGACCGAATAAGCGACCAGGATCTCAAGCAGC
AGGTGCGGCTCTATCGCTGAAGTGGCGCCGAGCCTGGGCTCACCCTACCT
GAATGTACAGACTTGTGTGATCTATTAGTTTAATGTTTAAAATTCCAAGA
TTTGGTGTTGCCTCATACGGTCCACTAAGTGCGGGCAAGTCTTTAGTCAG
AGAGCTATCTCATCAGTCGATGATGTCGGAATATAATATCTTAGTTGTAT
GTAAATTATATGTATTCCACTTCGATCTATGTATTTTGTGAGTTCCTGGT
GTTATTAATATCTGATTTAGATTTGTAGTAAATGGCTGTTCGGCTCTTAG
TCTCTTAAATCAGCTTTCGAATTAAGAATATATGTATATATTTTAACGTG
TTACAAGATAAAAACTCGCGATCAGAAAGTGTATAGATTTAAACACAATT
AATCGCCAAATTCGTTGGTTAGATTTAAATTGTGTTCATATAACTTTGGA
TTTATTTGTTCAATAAAGAATGTTTAGCTGTGTTAAGATGTAAAAAAAAA
AAAAAAAAAA

LD29166.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG7407-RA 1098 CG7407-RA 105..1097 1..993 4965 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:04:27
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21812661..21813506 146..991 4230 100 Plus
chr3L 24539361 chr3L 21812454..21812599 1..146 730 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:22:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:04:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21823726..21824573 146..993 4240 100 Plus
3L 28110227 3L 21823519..21823664 1..146 730 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:45
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21816826..21817673 146..993 4240 100 Plus
3L 28103327 3L 21816619..21816764 1..146 730 100 Plus
Blast to na_te.dros performed 2019-03-16 01:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 5020..5171 803..655 120 58.4 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 1215..1264 968..919 115 70 Minus

LD29166.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:05:34 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21812454..21812598 1..145 100 -> Plus
chr3L 21812661..21813506 146..991 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:09:16 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 1..507 14..520 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:18 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 1..507 14..520 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:13 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 1..507 14..520 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:48:07 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 1..507 14..520 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:21:29 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 1..507 14..520 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:13:21 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 55..1045 1..991 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:18 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 55..1045 1..991 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:13 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 59..1049 1..991 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:48:07 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 55..1045 1..991 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:21:29 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
CG7407-RA 59..1049 1..991 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:34 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21823519..21823663 1..145 100 -> Plus
3L 21823726..21824571 146..991 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:34 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21823519..21823663 1..145 100 -> Plus
3L 21823726..21824571 146..991 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:05:34 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21823519..21823663 1..145 100 -> Plus
3L 21823726..21824571 146..991 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:13 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21816619..21816763 1..145 100 -> Plus
arm_3L 21816826..21817671 146..991 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:31 Download gff for LD29166.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21816826..21817671 146..991 100   Plus
3L 21816619..21816763 1..145 100 -> Plus

LD29166.hyp Sequence

Translation from 0 to 519

> LD29166.hyp
KEFEMQDFLPSLDVLFLGLPGHYSVALVTLLLCVLVAFYFANIFKDKGEL
EDEGLGADEPRDEEDSESRTPQGEETDDDEAYEENSTESEVELIEEQLPE
HSYNHLMGQLKAKRLQHKMEKTLTPSQIEEERRIEREQLAAIFELLRKQE
AELNLQDRISDQDLKQQVRLYR*

LD29166.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7407-PA 168 CG7407-PA 1..168 5..172 852 100 Plus

LD29166.pep Sequence

Translation from 13 to 519

> LD29166.pep
MQDFLPSLDVLFLGLPGHYSVALVTLLLCVLVAFYFANIFKDKGELEDEG
LGADEPRDEEDSESRTPQGEETDDDEAYEENSTESEVELIEEQLPEHSYN
HLMGQLKAKRLQHKMEKTLTPSQIEEERRIEREQLAAIFELLRKQEAELN
LQDRISDQDLKQQVRLYR*

LD29166.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:56:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25172-PA 172 GF25172-PA 1..172 1..168 526 68.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16227-PA 169 GG16227-PA 1..169 1..168 743 92.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:56:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23264-PA 163 GH23264-PA 1..163 11..168 372 57 Plus
Dgri\GH23320-PA 163 GH23320-PA 1..163 11..168 372 57 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG7407-PA 168 CG7407-PA 1..168 1..168 852 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13632-PA 163 GI13632-PA 1..163 11..168 354 61.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:56:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24867-PA 173 GL24867-PA 1..173 1..168 516 68.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20329-PA 173 GA20329-PA 1..173 1..168 515 68.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:56:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22411-PA 168 GM22411-PA 1..168 1..168 759 94 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15003-PA 168 GD15003-PA 1..168 1..168 843 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:56:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13969-PA 164 GJ13969-PA 1..164 11..168 388 61.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16841-PA 188 GK16841-PA 12..188 11..168 393 59.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22588-PA 168 GE22588-PA 1..168 1..168 748 90.5 Plus