Clone LD29185 Report

Search the DGRC for LD29185

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:291
Well:85
Vector:pOT2
Associated Gene/TranscriptGie-RA
Protein status:LD29185.pep: gold
Preliminary Size:1087
Sequenced Size:897

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7891 2001-01-01 Release 2 assignment
CG7891 2002-03-29 Blastp of sequenced clone
CG7891 2003-01-01 Sim4 clustering to Release 3
CG7891 2008-04-29 Release 5.5 accounting
CG7891 2008-08-15 Release 5.9 accounting
CG7891 2008-12-18 5.12 accounting

Clone Sequence Records

LD29185.complete Sequence

897 bp (897 high quality bases) assembled on 2002-03-29

GenBank Submission: AY094809

> LD29185.complete
CTTTGGAAAAGGAAACCTTTTTTCGCGAATTTCAAGCAGATCCCGACCAG
AAACACACCTGCCCCAGGATGTTGGCCCTCATCAACAGGATCCTCGAGTG
GTTCAAGAGCATCTTCTGGAAAGAGGAGATGGAACTCACGCTAGTGGGGC
TGCAGTTCTCCGGGAAGACGACGTTCGTCAATGTTATTGCATCCGGCCAA
TTCGCTGAGGACATGATACCCACAGTTGGATTCAACATGCGCAAGATCAC
CAGAGGCAATGTGACTATCAAGGTGTGGGACATCGGAGGCCAACCTCGAT
TCCGATCCATGTGGGAGCGCTATTGTCGCGGCGTTAATGCGATTGTCTAC
ATGGTGGACGCAGCCGATCTGGACAAATTAGAGGCCTCGAGGAACGAGCT
GCACTCACTGTTGGACAAACCGCAGCTCGCCGGCATTCCAGTTCTCGTGC
TGGGCAATAAACGAGATCTTCCAGGCGCTCTCGATGAAACCGGACTCATC
GAACGAATGAATCTATCGAGCATACAGGACCGTGAAATCTGCTGTTATAG
TATTTCCTGCAAGGAGAAGGACAACATTGACATCACGCTGCAGTGGTTAA
TTCAACATTCGAAAAGCCAAAGTCGTTAGATAACGAACACCGACATACAC
ACAACTCCGTACCCTCTACACTCACACACTTAGGCACTATATCTCACACA
TATTTTAATTTTATTGTTTTTGTATTCATTATATATTTTACATTTCGCTT
ATATGCTTCGATGCGGATTATTTTCAACTGGAATTTTTGCTTAGCGAAAA
CTGGAATGCGAAAGCAGCGGAAAAGCATAAATTATAAAGACGTTTTAAAC
TATAAATATATATTAAAACAATAAAAAAAAAAAAAAAAAAAAAAAAA

LD29185.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:17:57
Subject Length Description Subject Range Query Range Score Percent Strand
Gie-RA 1370 Gie-RA 50..922 1..873 4365 100 Plus
Gie.c 1291 Gie.c 50..922 1..873 4365 100 Plus
Gie.b 743 Gie.b 70..743 192..865 3370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3954521..3954884 509..872 1820 100 Plus
chr3R 27901430 chr3R 3952683..3952873 1..191 955 100 Plus
chr3R 27901430 chr3R 3954293..3954455 347..509 815 100 Plus
chr3R 27901430 chr3R 3954072..3954226 192..346 775 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:22:10 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8128490..8128854 509..873 1825 100 Plus
3R 32079331 3R 8126652..8126842 1..191 955 100 Plus
3R 32079331 3R 8128262..8128424 347..509 815 100 Plus
3R 32079331 3R 8128041..8128195 192..346 775 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:47:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7869321..7869685 509..873 1825 100 Plus
3R 31820162 3R 7867483..7867673 1..191 955 100 Plus
3R 31820162 3R 7869093..7869255 347..509 815 100 Plus
3R 31820162 3R 7868872..7869026 192..346 775 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:09:59 has no hits.

LD29185.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:10:40 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3952683..3952873 1..191 100 -> Plus
chr3R 3954072..3954226 192..346 100 -> Plus
chr3R 3954293..3954454 347..508 100 -> Plus
chr3R 3954521..3954884 509..872 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:09:20 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
CG7891-RA 1..561 69..629 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:21:30 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
Gie-RA 1..561 69..629 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:24 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
Gie-RA 1..561 69..629 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:58:38 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
CG7891-RA 1..561 69..629 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:29:46 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
Gie-RA 1..561 69..629 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:48:29 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
CG7891-RA 39..903 1..865 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:21:30 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
Gie-RA 39..903 1..865 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:24 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
Gie-RB 48..919 1..872 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:58:39 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
CG7891-RA 39..903 1..865 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:29:46 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
Gie-RB 48..919 1..872 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:40 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8126652..8126842 1..191 100 -> Plus
3R 8128041..8128195 192..346 100 -> Plus
3R 8128262..8128423 347..508 100 -> Plus
3R 8128490..8128853 509..872 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:40 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8126652..8126842 1..191 100 -> Plus
3R 8128041..8128195 192..346 100 -> Plus
3R 8128262..8128423 347..508 100 -> Plus
3R 8128490..8128853 509..872 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:10:40 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8126652..8126842 1..191 100 -> Plus
3R 8128041..8128195 192..346 100 -> Plus
3R 8128262..8128423 347..508 100 -> Plus
3R 8128490..8128853 509..872 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:24 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3953763..3953917 192..346 100 -> Plus
arm_3R 3953984..3954145 347..508 100 -> Plus
arm_3R 3952374..3952564 1..191 100 -> Plus
arm_3R 3954212..3954575 509..872 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:31:18 Download gff for LD29185.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7869321..7869684 509..872 100   Plus
3R 7867483..7867673 1..191 100 -> Plus
3R 7868872..7869026 192..346 100 -> Plus
3R 7869093..7869254 347..508 100 -> Plus

LD29185.hyp Sequence

Translation from 2 to 628

> LD29185.hyp
LEKETFFREFQADPDQKHTCPRMLALINRILEWFKSIFWKEEMELTLVGL
QFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRF
RSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVL
GNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLI
QHSKSQSR*

LD29185.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Gie-PC 186 CG7891-PC 1..186 23..208 967 100 Plus
Gie-PB 186 CG7891-PB 1..186 23..208 967 100 Plus
Gie-PA 186 CG7891-PA 1..186 23..208 967 100 Plus
Arf51F-PE 175 CG8156-PE 8..174 37..204 300 34.5 Plus
Arf51F-PA 175 CG8156-PA 8..174 37..204 300 34.5 Plus

LD29185.pep Sequence

Translation from 68 to 628

> LD29185.pep
MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMI
PTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAAD
LDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLS
SIQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR*

LD29185.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18845-PA 186 GF18845-PA 1..186 1..186 986 99.5 Plus
Dana\GF13030-PA 175 GF13030-PA 5..174 12..182 298 33.9 Plus
Dana\GF24106-PA 180 GF24106-PA 4..172 8..177 293 32.4 Plus
Dana\GF23441-PA 182 GF23441-PA 9..182 12..186 289 30.9 Plus
Dana\GF23416-PA 180 GF23416-PA 12..173 15..177 267 30.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:46:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23372-PA 186 GG23372-PA 1..186 1..186 990 100 Plus
Dere\GG20511-PA 175 GG20511-PA 5..174 12..182 299 33.9 Plus
Dere\GG15940-PA 190 GG15940-PA 14..182 8..177 291 32.4 Plus
Dere\GG13164-PA 182 GG13164-PA 9..182 12..186 289 30.9 Plus
Dere\GG16407-PA 180 GG16407-PA 12..173 15..177 265 30.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18326-PA 186 GH18326-PA 1..186 1..186 968 97.8 Plus
Dgri\GH14778-PA 180 GH14778-PA 4..172 8..177 293 32.4 Plus
Dgri\GH20425-PA 175 GH20425-PA 5..174 12..182 291 33.3 Plus
Dgri\GH14762-PA 182 GH14762-PA 9..182 12..186 289 30.9 Plus
Dgri\GH14763-PA 182 GH14763-PA 9..182 12..186 273 32 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
Arl8-PC 186 CG7891-PC 1..186 1..186 967 100 Plus
Arl8-PB 186 CG7891-PB 1..186 1..186 967 100 Plus
Arl8-PA 186 CG7891-PA 1..186 1..186 967 100 Plus
Arf51F-PE 175 CG8156-PE 8..174 15..182 300 34.5 Plus
Arf51F-PA 175 CG8156-PA 8..174 15..182 300 34.5 Plus
Arf51F-PC 175 CG8156-PC 8..174 15..182 300 34.5 Plus
Arf51F-PB 175 CG8156-PB 8..174 15..182 300 34.5 Plus
Arf51F-PD 175 CG8156-PD 8..174 15..182 300 34.5 Plus
Arl1-PA 180 CG6025-PA 4..172 8..177 292 32.4 Plus
Arf79F-PJ 182 CG8385-PJ 9..182 12..186 290 30.9 Plus
Arf79F-PI 182 CG8385-PI 9..182 12..186 290 30.9 Plus
Arf79F-PH 182 CG8385-PH 9..182 12..186 290 30.9 Plus
Arf79F-PF 182 CG8385-PF 9..182 12..186 290 30.9 Plus
Arf79F-PC 182 CG8385-PC 9..182 12..186 290 30.9 Plus
Arf79F-PE 182 CG8385-PE 9..182 12..186 290 30.9 Plus
Arf79F-PB 182 CG8385-PB 9..182 12..186 290 30.9 Plus
Arf79F-PA 182 CG8385-PA 9..182 12..186 290 30.9 Plus
Arl2-PA 184 CG7435-PA 14..173 18..178 275 35.4 Plus
Arf102F-PB 180 CG11027-PB 12..173 15..177 270 30.7 Plus
Arf102F-PA 180 CG11027-PA 12..173 15..177 270 30.7 Plus
dnd-PA 179 CG6560-PA 15..178 18..182 246 29.1 Plus
Sar1-PE 193 CG7073-PE 3..142 8..143 242 36.2 Plus
Sar1-PC 193 CG7073-PC 3..142 8..143 242 36.2 Plus
Sar1-PD 193 CG7073-PD 3..142 8..143 242 36.2 Plus
Sar1-PA 193 CG7073-PA 3..142 8..143 242 36.2 Plus
Arl5-PA 179 CG7197-PA 11..179 15..184 237 27.6 Plus
Arl6-PB 201 CG7735-PB 15..183 18..182 220 29 Plus
Arl6-PA 202 CG7735-PA 15..184 18..182 220 29.4 Plus
Arl4-PA 312 CG2219-PA 25..160 21..152 220 33.6 Plus
Arl4-PB 313 CG2219-PB 26..161 21..152 220 33.6 Plus
Arfrp1-PA 200 CG7039-PA 8..188 11..182 218 25.4 Plus
CG17819-PA 186 CG17819-PA 23..177 23..177 177 25.2 Plus
Rab4-PA 213 CG4921-PA 13..159 25..171 158 31.4 Plus
Rab4-PB 213 CG4921-PB 13..159 25..171 158 31.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:46:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23307-PA 186 GI23307-PA 1..186 1..186 977 98.4 Plus
Dmoj\GI11881-PA 180 GI11881-PA 4..172 8..177 293 32.4 Plus
Dmoj\GI19608-PA 175 GI19608-PA 5..174 12..182 291 33.3 Plus
Dmoj\GI11864-PA 182 GI11864-PA 9..182 12..186 289 30.9 Plus
Dmoj\GI14031-PA 180 GI14031-PA 12..173 15..177 270 30.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:46:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24258-PA 186 GL24258-PA 1..186 1..186 986 99.5 Plus
Dper\GL17751-PA 175 GL17751-PA 5..174 12..182 300 33.9 Plus
Dper\GL12747-PA 180 GL12747-PA 4..172 8..177 293 32.4 Plus
Dper\GL25178-PA 182 GL25178-PA 9..182 12..186 289 30.9 Plus
Dper\GL23431-PA 184 GL23431-PA 14..173 18..178 280 35.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20665-PA 186 GA20665-PA 1..186 1..186 986 99.5 Plus
Dpse\GA20856-PA 175 GA20856-PA 5..174 12..182 300 33.9 Plus
Dpse\GA19306-PA 180 GA19306-PA 4..172 8..177 293 32.4 Plus
Dpse\GA21036-PA 182 GA21036-PA 9..182 12..186 289 30.9 Plus
Dpse\GA20349-PA 184 GA20349-PA 14..173 18..178 280 35.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:46:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23705-PA 256 GM23705-PA 1..175 1..175 934 100 Plus
Dsec\GM21603-PA 175 GM21603-PA 5..174 12..182 299 33.9 Plus
Dsec\GM25571-PA 180 GM25571-PA 4..172 8..177 293 32.4 Plus
Dsec\GM22073-PA 182 GM22073-PA 9..182 12..186 289 30.9 Plus
Dsec\GM23726-PA 184 GM23726-PA 14..173 18..178 269 35.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18515-PA 186 GD18515-PA 1..186 1..186 990 100 Plus
Dsim\GD11108-PA 175 GD11108-PA 5..174 12..182 299 33.9 Plus
Dsim\GD14586-PA 180 GD14586-PA 4..172 8..177 293 32.4 Plus
Dsim\GD12049-PA 182 GD12049-PA 9..182 12..186 289 30.9 Plus
Dsim\GD18536-PA 184 GD18536-PA 14..173 18..178 269 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:46:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24163-PA 202 GJ24163-PA 1..202 1..186 950 90.6 Plus
Dvir\GJ13575-PA 180 GJ13575-PA 4..172 8..177 293 32.4 Plus
Dvir\GJ14973-PA 175 GJ14973-PA 5..174 12..182 291 33.3 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 9..182 12..186 289 30.9 Plus
Dvir\GJ19602-PA 180 GJ19602-PA 12..173 15..177 270 30.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14379-PA 186 GK14379-PA 1..185 1..185 967 97.8 Plus
Dwil\GK20891-PA 175 GK20891-PA 5..174 12..182 297 33.9 Plus
Dwil\GK20496-PA 182 GK20496-PA 9..182 12..186 289 30.9 Plus
Dwil\GK13183-PA 184 GK13183-PA 14..173 18..178 280 36 Plus
Dwil\GK24495-PA 167 GK24495-PA 3..159 20..177 275 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25851-PA 186 GE25851-PA 1..186 1..186 990 100 Plus
Dyak\GE13644-PA 175 GE13644-PA 5..174 12..182 299 33.9 Plus
Dyak\GE22880-PA 180 GE22880-PA 4..172 8..177 293 32.4 Plus
Dyak\GE19486-PA 182 GE19486-PA 9..182 12..186 289 30.9 Plus
Dyak\GE25871-PA 184 GE25871-PA 14..173 18..178 267 34.8 Plus