Clone LD29276 Report

Search the DGRC for LD29276

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:292
Well:76
Vector:pOT2
Associated Gene/TranscriptCG8461-RA
Protein status:LD29276.pep: gold
Preliminary Size:1064
Sequenced Size:869

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8461 2001-01-01 Release 2 assignment
CG8461 2001-10-10 Blastp of sequenced clone
CG8461 2003-01-01 Sim4 clustering to Release 3
CG8461 2008-04-29 Release 5.5 accounting
CG8461 2008-08-15 Release 5.9 accounting
CG8461 2008-12-18 5.12 accounting

Clone Sequence Records

LD29276.complete Sequence

869 bp (869 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061371

> LD29276.complete
ACACGTGAATTTCTTAAAAAGTAAATAAATAAAATTTTAAACGAAAACTA
AAACAAAAATGTCCTCTCCCAGTGAATCCTCTTCAGCTTCTGAGCACGAG
GCTAGCGATGACAACGAAACTCAGAATGCCATTCGCGAAGATCTCAAAGG
AATGTCATTCGAGGAGATAATGAAACTAAAAGAGGAGCTGGGCGCCAAGG
TGTACAAAGAGGCTGTGCTCGGTAGCAAGAGTTCTAGACCCCAAAAACCA
AAGGCCAAAACCGACCTCAAGCGGCTAAACAAAAACCGACCTCGTGAAAT
GACCACCAGACGACAGGTTCCATTTTTGGGCGCCGAGCACAGAGTGGAGC
GGAAAAAAAATGTTGAACTCAGAGATCCAAGATTTGACGAAAAATCCGGA
ACATATAGTGCAGAAACCTTCAAGAAGAACTACCAGTTTGTCTCCCAGAT
TCGAGCAAAGGAAGTTGGTCAGCTGAAGAAAAAACTGGACGAAGTGGAGG
ATGAGGCGGAGAAGCACCATATAAAGGACACCATGCAGCGACTTATCAAT
AAAAATGTGGAGGACAAGAAGTGGCACACCAAACAGAAGCAACTGAAAAA
GGAGCGCTCCGCCATTCAGAAGAAACACGATTTGGGACAACAACCTCATT
ATCTGACAAAGAAGGAGCGTCGAGCTAAGGAACTAGTTGCCCAATTCGAG
AAGCTGAAAAACACTGGAAAACTCAACAAGCACATGGAAAAGCGACGCAA
GAAGAACGCCGCCAAGGACCGCAAACGCATTGGTATAGAATAAGACTTAC
GCTTTAAGTATAAATGTATTTTAAACAATTAAAAGCACAGTGCAAATAAG
CAAAAAAAAAAAAAAAAAA

LD29276.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG8461-RA 889 CG8461-RA 36..889 1..854 4270 100 Plus
mRpL11-RA 813 mRpL11-RA 756..813 854..797 290 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 13:40:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10337639..10338178 662..123 2700 100 Minus
chr3R 27901430 chr3R 10337395..10337583 851..663 945 100 Minus
chr3R 27901430 chr3R 10338238..10338361 124..1 620 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:22:21 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 13:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14512883..14513422 662..123 2700 100 Minus
3R 32079331 3R 14512636..14512827 854..663 960 100 Minus
3R 32079331 3R 14513482..14513605 124..1 620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:23:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14253714..14254253 662..123 2700 100 Minus
3R 31820162 3R 14253467..14253658 854..663 960 100 Minus
3R 31820162 3R 14254313..14254436 124..1 620 100 Minus
Blast to na_te.dros performed 2019-03-15 13:40:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 534..583 847..797 108 70.6 Minus
3S18 6126 3S18 DM23420 6126bp Derived from U23420 (g733531) (Rel. 48, Last updated, Version 3). 3194..3247 156..209 108 66.7 Plus

LD29276.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 13:42:03 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10337395..10337583 663..851 100 <- Minus
chr3R 10337639..10338176 125..662 100 <- Minus
chr3R 10338238..10338318 44..124 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:09:33 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 1..735 59..793 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:31:30 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 1..735 59..793 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 22:08:13 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 1..735 59..793 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:59:11 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 1..735 59..793 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:36:55 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 1..735 59..793 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:09:56 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:31:30 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 1..851 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 22:08:13 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 33..883 1..851 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:59:11 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 2..852 1..851 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:36:55 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
CG8461-RA 33..883 1..851 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:42:03 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14512639..14512827 663..851 100 <- Minus
3R 14512883..14513420 125..662 100 <- Minus
3R 14513482..14513605 1..124 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:42:03 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14512639..14512827 663..851 100 <- Minus
3R 14512883..14513420 125..662 100 <- Minus
3R 14513482..14513605 1..124 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 13:42:03 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14512639..14512827 663..851 100 <- Minus
3R 14512883..14513420 125..662 100 <- Minus
3R 14513482..14513605 1..124 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 22:08:13 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10338361..10338549 663..851 100 <- Minus
arm_3R 10338605..10339142 125..662 100 <- Minus
arm_3R 10339204..10339327 1..124 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:35:38 Download gff for LD29276.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14253714..14254251 125..662 100 <- Minus
3R 14254313..14254436 1..124 100   Minus
3R 14253470..14253658 663..851 100 <- Minus

LD29276.pep Sequence

Translation from 58 to 792

> LD29276.pep
MSSPSESSSASEHEASDDNETQNAIREDLKGMSFEEIMKLKEELGAKVYK
EAVLGSKSSRPQKPKAKTDLKRLNKNRPREMTTRRQVPFLGAEHRVERKK
NVELRDPRFDEKSGTYSAETFKKNYQFVSQIRAKEVGQLKKKLDEVEDEA
EKHHIKDTMQRLINKNVEDKKWHTKQKQLKKERSAIQKKHDLGQQPHYLT
KKERRAKELVAQFEKLKNTGKLNKHMEKRRKKNAAKDRKRIGIE*

LD29276.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 11:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17479-PA 249 GF17479-PA 3..247 2..243 1004 80.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 11:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21274-PA 244 GG21274-PA 1..244 1..244 1163 95.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 11:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17448-PA 244 GH17448-PA 1..244 1..244 891 73.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8461-PA 244 CG8461-PA 1..244 1..244 1244 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 11:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22774-PA 244 GI22774-PA 1..244 1..244 879 72.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 11:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23657-PA 245 GL23657-PA 16..245 15..244 952 80.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 11:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21095-PA 245 GA21095-PA 16..245 15..244 948 80 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 11:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25849-PA 244 GM25849-PA 1..244 1..244 1239 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 11:11:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20416-PA 244 GD20416-PA 1..244 1..244 1249 98 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 11:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22776-PA 244 GJ22776-PA 1..244 1..244 869 71.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 11:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12146-PA 246 GK12146-PA 18..246 18..244 881 76 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 11:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26446-PA 244 GE26446-PA 1..244 1..244 1171 96.3 Plus

LD29276.hyp Sequence

Translation from 58 to 792

> LD29276.hyp
MSSPSESSSASEHEASDDNETQNAIREDLKGMSFEEIMKLKEELGAKVYK
EAVLGSKSSRPQKPKAKTDLKRLNKNRPREMTTRRQVPFLGAEHRVERKK
NVELRDPRFDEKSGTYSAETFKKNYQFVSQIRAKEVGQLKKKLDEVEDEA
EKHHIKDTMQRLINKNVEDKKWHTKQKQLKKERSAIQKKHDLGQQPHYLT
KKERRAKELVAQFEKLKNTGKLNKHMEKRRKKNAAKDRKRIGIE*

LD29276.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:34:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG8461-PA 244 CG8461-PA 1..244 1..244 1244 100 Plus