Clone LD29280 Report

Search the DGRC for LD29280

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:292
Well:80
Vector:pOT2
Associated Gene/TranscriptND42-RA
Protein status:LD29280.pep: gold
Preliminary Size:1561
Sequenced Size:1379

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6343 2001-01-01 Release 2 assignment
CG6343 2001-07-04 Blastp of sequenced clone
CG6343 2003-01-01 Sim4 clustering to Release 3
ND42 2008-04-29 Release 5.5 accounting
ND42 2008-08-15 Release 5.9 accounting
ND42 2008-12-18 5.12 accounting

Clone Sequence Records

LD29280.complete Sequence

1379 bp (1379 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051764

> LD29280.complete
CAACCATAGCCCGAAATTTGTTTTTGGGTAGACTTCCGATATTTAGATTG
AAAAAATGACCGCCGTGTTCCGCGTAGGACTGGTGCGGCTCGTCAGCCGC
GCCACACAGTCGCCCAATCTACTCCAGGCGCAGACGAATGCCCTGCCTGC
TGCCTTCCAGCAGCGATGCAGCATCTCCGGCAAGACGATGCGAGGTGGAC
CACGGGTGCCCAAGGCCGCCCCCTATCCGTACAAGACGAAGAAGTACAGC
GTGTTCAATGCTATTTTCGACAAGACCTCCAAGCGTTTTGACGAGAACTC
CAAGGTGATCTGTGTGGAGGGACCCATCGCGGCCGGCAAGTCAAAGTTCG
CCAAGGAACTGGCTGAGGAGCTGGACATGGAGTACTATCCGGCAGTTGAT
CTGGACCTAATCTACATCAATTCGTACGGCTATGACATGAGGAAGTTGGA
TCCTCAGTTGCCGCCCAGCTGCCGAAGCTACGATGTGCGCAACTTCTGCC
TGGATCCCAGCCACGATCTGGCTGCCCAGTTCCAGATTCGCATGTACATG
CTGCGCTATTCGCAGTACATTGATGCCCTGCAGCACGTCCTTAGCACCGG
CCAGGGTGTTGTCCTCGAGCGCAGCCCCTACTCGGACTTTGTCTTCATGG
AGGCCATGTTTCGGCAGGGTTATCTGTCACGCGGTGCGCGTTCCGTGTAT
AATGAGCTCCGACAGAACACCATCGGGGAGCTGCTGAAGCCGCATTTGGT
TATCTACTTGGATCTGCCGGTCGATGCCGTGAAGAAGCAGATCAAGGCAC
GCAATGTGGACTACGAGGTGCAGTCAAAGGTGTTCAGCGATGCCTACTTG
AGCGATTTGGAGCAGCTGTACAAGCAGCAGTACCTCAAGGACATCTCCAC
CCATGCCGAGCTGCTCATCTACGACTGGACAGCCGGCGGTGAGACTGAGG
TTGTGGTGGAGGATATCGAACGCATCGACTTCAACCAGTTTGAGGCCGAT
ATTCACAACAAGAAGATGCTCGACTGGCGTTTCCCGCTGGAGGCCGAGTG
GTGCGAAGCCCGTATCAAGTACTGCCATGAGAAGCCCGATCTGATGAATT
ACTTCAATGTGCCGCGTTTCGATGTCCCGGAGCTGGTGCGCAGCGCTGAC
GACGGCAAAGTCTGGCGTGATGTCTGGTTCAATGCTCCCGGCATGAAGTA
CCGTCCTGGCTACAATGCAGACATGGGCGACGAGGGTCTCCTCACCAAGA
CGAAAATAGGCATCAACCAGGGCATCTAGAGGGTTTTTGCTATGCTTTCG
AGTTGAAATCACCTGGCGAAATGTGTTAATTATCTAATAAACAGTCTAGT
AAAATAATCAGAAAAAAAAAAAAAAAAAA

LD29280.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
ND42-RA 1493 ND42-RA 81..1443 1..1363 6815 100 Plus
ND42-RB 1617 ND42-RB 300..1608 55..1363 6545 100 Plus
ND42.a 1408 ND42.a 50..1358 55..1363 6545 100 Plus
ND42-RB 1617 ND42-RB 7..60 1..54 270 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 17851783..17852912 55..1184 5605 99.7 Plus
chr3R 27901430 chr3R 17852979..17853156 1184..1361 890 100 Plus
chr3R 27901430 chr3R 17851490..17851543 1..54 270 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:22:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 22028020..22029149 55..1184 5650 100 Plus
3R 32079331 3R 22029216..22029395 1184..1363 900 100 Plus
3R 32079331 3R 22027727..22027780 1..54 270 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 21768851..21769980 55..1184 5650 100 Plus
3R 31820162 3R 21770047..21770226 1184..1363 900 100 Plus
3R 31820162 3R 21768558..21768611 1..54 270 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:56:47 has no hits.

LD29280.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:57:31 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 17851490..17851543 1..54 100 -> Plus
chr3R 17851783..17852911 55..1183 99 -> Plus
chr3R 17852979..17853156 1184..1361 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:09:34 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RB 1..1224 56..1279 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:20:24 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RB 1..1224 56..1279 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:20:35 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RA 1..1224 56..1279 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:52:01 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RB 1..1224 56..1279 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:21:19 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RA 1..1224 56..1279 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:16:45 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RA 23..1383 1..1361 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:20:24 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RA 23..1383 1..1361 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:20:35 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RA 19..1379 1..1361 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:52:02 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RA 23..1383 1..1361 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:21:19 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
ND42-RA 19..1379 1..1361 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:31 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22027727..22027780 1..54 100 -> Plus
3R 22028020..22029148 55..1183 100 -> Plus
3R 22029216..22029393 1184..1361 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:31 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22027727..22027780 1..54 100 -> Plus
3R 22028020..22029148 55..1183 100 -> Plus
3R 22029216..22029393 1184..1361 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:57:31 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22027727..22027780 1..54 100 -> Plus
3R 22028020..22029148 55..1183 100 -> Plus
3R 22029216..22029393 1184..1361 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:20:35 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17853449..17853502 1..54 100 -> Plus
arm_3R 17853742..17854870 55..1183 100 -> Plus
arm_3R 17854938..17855115 1184..1361 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:30:31 Download gff for LD29280.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21768558..21768611 1..54 100 -> Plus
3R 21768851..21769979 55..1183 100 -> Plus
3R 21770047..21770224 1184..1361 100   Plus

LD29280.pep Sequence

Translation from 55 to 1278

> LD29280.pep
MTAVFRVGLVRLVSRATQSPNLLQAQTNALPAAFQQRCSISGKTMRGGPR
VPKAAPYPYKTKKYSVFNAIFDKTSKRFDENSKVICVEGPIAAGKSKFAK
ELAEELDMEYYPAVDLDLIYINSYGYDMRKLDPQLPPSCRSYDVRNFCLD
PSHDLAAQFQIRMYMLRYSQYIDALQHVLSTGQGVVLERSPYSDFVFMEA
MFRQGYLSRGARSVYNELRQNTIGELLKPHLVIYLDLPVDAVKKQIKARN
VDYEVQSKVFSDAYLSDLEQLYKQQYLKDISTHAELLIYDWTAGGETEVV
VEDIERIDFNQFEADIHNKKMLDWRFPLEAEWCEARIKYCHEKPDLMNYF
NVPRFDVPELVRSADDGKVWRDVWFNAPGMKYRPGYNADMGDEGLLTKTK
IGINQGI*

LD29280.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18063-PA 407 GF18063-PA 1..407 1..407 2025 89.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11101-PA 407 GG11101-PA 1..407 1..407 2104 94.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:25:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20975-PA 408 GH20975-PA 1..406 1..405 1918 85.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:59
Subject Length Description Subject Range Query Range Score Percent Strand
ND-42-PC 407 CG6343-PC 1..407 1..407 2146 100 Plus
ND-42-PB 407 CG6343-PB 1..407 1..407 2146 100 Plus
ND-42-PA 407 CG6343-PA 1..407 1..407 2146 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10455-PA 410 GI10455-PA 1..408 1..405 1871 81.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:25:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24009-PA 408 GL24009-PA 1..408 1..407 2001 88.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19526-PA 408 GA19526-PA 1..408 1..407 2004 88.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26394-PA 407 GM26394-PA 1..407 1..407 2162 98 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20916-PA 407 GD20916-PA 1..407 1..407 2166 98.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23142-PA 408 GJ23142-PA 1..406 1..405 1903 85.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14239-PA 412 GK14239-PA 1..412 1..407 1962 86.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:25:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10263-PA 407 GE10263-PA 1..407 1..407 2114 95.6 Plus

LD29280.hyp Sequence

Translation from 55 to 1278

> LD29280.hyp
MTAVFRVGLVRLVSRATQSPNLLQAQTNALPAAFQQRCSISGKTMRGGPR
VPKAAPYPYKTKKYSVFNAIFDKTSKRFDENSKVICVEGPIAAGKSKFAK
ELAEELDMEYYPAVDLDLIYINSYGYDMRKLDPQLPPSCRSYDVRNFCLD
PSHDLAAQFQIRMYMLRYSQYIDALQHVLSTGQGVVLERSPYSDFVFMEA
MFRQGYLSRGARSVYNELRQNTIGELLKPHLVIYLDLPVDAVKKQIKARN
VDYEVQSKVFSDAYLSDLEQLYKQQYLKDISTHAELLIYDWTAGGETEVV
VEDIERIDFNQFEADIHNKKMLDWRFPLEAEWCEARIKYCHEKPDLMNYF
NVPRFDVPELVRSADDGKVWRDVWFNAPGMKYRPGYNADMGDEGLLTKTK
IGINQGI*

LD29280.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
ND42-PC 407 CG6343-PC 1..407 1..407 2146 100 Plus
ND42-PB 407 CG6343-PB 1..407 1..407 2146 100 Plus
ND42-PA 407 CG6343-PA 1..407 1..407 2146 100 Plus