Clone LD29815 Report

Search the DGRC for LD29815

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:298
Well:15
Vector:pOT2
Associated Gene/TranscriptArpc2-RA
Protein status:LD29815.pep: gold
Preliminary Size:2262
Sequenced Size:1935

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10954 2001-01-01 Release 2 assignment
CG10954 2001-09-19 Blastp of sequenced clone
CG10954 2003-01-01 Sim4 clustering to Release 3
Arc-p34 2008-04-29 Release 5.5 accounting
Arc-p34 2008-08-15 Release 5.9 accounting
Arc-p34 2008-12-18 5.12 accounting

Clone Sequence Records

LD29815.complete Sequence

1935 bp (1935 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060391

> LD29815.complete
ACGCTGTGAGCAAGGAAAATACGGCAGCGTGCTCCCCGTTTTCCATCCAC
GTTTTGTTATAATTTTATAAGTATTACGGTCTGAGACCGATTTTGCACTG
CATCGTGCGCGCTGCAAGTACTGGCGATTGGAAATTGGAGGCGCGAAAAG
AGGATAAGGTGGATTTTCTTGCAACTGTGTGTGTGAGCATTGGAATTCGC
CCGTGTGTGTGGCGAGAGTGCGTCCATGTGTGTGTGACGGACCAAAAAAG
CCGACATCAGCGCCCATTTTTTGTTGTTGATTCATTAATACGCCCGTCAT
GCACCAGTATTGGTGAGTTGGAGCAGCGCACCGTCTTACTCGCACTCAAC
GGAGCGCAGAAAGAGCGCAGGGAGCGGCAGAAGAAGAAGCAGCGAGCAGC
AGCACCATTAGCGGCAGTCAACGTCATATAATTTGTCATCGAAATTGGCA
CACTAAAAATAACAGTTAACTTCAACCGCCATGATCCTGCTGGAAATCAA
TAATCGGATTATCGAGGAGACGCTGCTGGTCAAATACCGTAATGCCCAGG
CTGGACTGAAGCCTGAATCGATAGACATACGAATAGCAGACTTCGACGGC
GTCCTTTATCACATTTCCAATGTGAATGGCGATAAAACAAAAGTTCGGAT
CAGCATATCGCTGAAGTTCTACAAACAGCTGCAAGAACATGGAGCCGACG
AGTTGCTGAAGCGTGAATATGGCAGTCTGCTTACAGACACGGAAGAAGGC
TACAATGTTTCCGTACTTATCAACCTGGAGGAGATTCCCGAGGACTGCGA
GCAAATCGCAAAGAGAATCGGACTGCTGAAGCGCAACTGTTTCGCATCGG
TTTTTGAAAAGTATTTTGACTATCAGGAGCAGGGCGAAGAGGGCCAAAAG
CGTGCCGTCATTAACTACCGCAACGATGAGACTTTATATGTGGAAGCCAA
GCCTGATCGTGTCACCGTCGTCTTTAGTACCATTTTCCGGGACGAAGACG
ATGTCATTATCGGCAAAGTATTTATGCAGGAATTGAGGGAAGGTCGGCGT
GCCTCGCACACCGCACCACAAGTGCTCTTTTCGCACCGAGAACCACCATT
GGAATTGGCCAACACGGACGCTAGGGTGGGCGACAACATTGGCTATGTCA
CATTCGTACTCTTCCCTCGGCATACCAACAAAGAAACAAGGGACAATACC
ATTAACTTAATTCACATGTTCCGAGATTACTTGCACTACCACATTAAGTG
TTCAAAGGCTTACATTCATTCGCGCATGCGAGCAAAAACCTCGGATTTCC
TCAAGGTGCTAAATCGTGCAAGGCCAGAGCCCAAAAACACGGAGAAGAAA
ACTATAACGGGGAGAACTTTCAAGCGCATCGATTGATGTGTTCAGTATAT
TTAGTTGTTTTTATATAAATACAAAAAATAAATTGTGTATTAAAATTCGA
TATCCGAATGGTGAATCCAACATAAACTAAACCAGATTGCAAGACAAACC
CAAGTATTCCAAACAGAACCGTAAGGCTAAATGTAAGCTCAGCAAAATAA
TGATCAAAGAATTAATAGTTACGCGTTAGTAAATGAATTGTGTGTGTTTG
TGTCGAGTCATCGTCAAATCCGTGTCTCCGCCAATTTGTTACAGTCATAG
GCCGAGTCAGCGCCACAGCTGAGCCGCATTTTAAACAAATAAACGTAGAC
TTAAGTGCAACATGAGAACTAAAACTACCATGTCAAAGCGAGCAACACGA
CTAAGGGATGCCACCAACTTGTTATATAGTCGCAATGGAGGATTCATCCC
CGCAATTAGCCTGTATGTGTAGAAAGCGCATTTAAAAACGTACTGCAAAT
ATTAACAAACCTTTGATACAGCAATCGGAATTAATAAAAACGAGAAAATC
AAACTGCAATGTAAAATAAAAAAAAAAAAAAAAAA

LD29815.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
Arc-p34-RA 2104 Arc-p34-RA 135..2058 1..1924 9620 100 Plus
Arc-p34.b 1980 Arc-p34.b 54..1980 1..1924 9565 99.8 Plus
Arc-p34.a 1972 Arc-p34.a 54..1972 1..1924 9520 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20420887..20421445 1359..1917 2795 100 Plus
chr2L 23010047 chr2L 20415523..20416076 1..554 2755 99.8 Plus
chr2L 23010047 chr2L 20419315..20419535 936..1156 1105 100 Plus
chr2L 23010047 chr2L 20419064..20419252 747..935 945 100 Plus
chr2L 23010047 chr2L 20420718..20420830 1247..1359 565 100 Plus
chr2L 23010047 chr2L 20418907..20419008 648..749 510 100 Plus
chr2L 23010047 chr2L 20420562..20420654 1156..1248 465 100 Plus
chr2L 23010047 chr2L 20418736..20418830 554..648 460 98.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:23:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20422469..20423034 1359..1924 2830 100 Plus
2L 23513712 2L 20417114..20417667 1..554 2770 100 Plus
2L 23513712 2L 20420897..20421117 936..1156 1105 100 Plus
2L 23513712 2L 20420646..20420834 747..935 945 100 Plus
2L 23513712 2L 20422300..20422412 1247..1359 565 100 Plus
2L 23513712 2L 20420489..20420590 648..749 510 100 Plus
2L 23513712 2L 20420318..20420412 554..648 475 100 Plus
2L 23513712 2L 20422144..20422236 1156..1248 465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:42:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20422469..20423034 1359..1924 2830 100 Plus
2L 23513712 2L 20417114..20417667 1..554 2770 100 Plus
2L 23513712 2L 20420897..20421117 936..1156 1105 100 Plus
2L 23513712 2L 20420646..20420834 747..935 945 100 Plus
2L 23513712 2L 20422300..20422412 1247..1359 565 100 Plus
2L 23513712 2L 20420489..20420590 648..749 510 100 Plus
2L 23513712 2L 20420318..20420412 554..648 475 100 Plus
2L 23513712 2L 20422144..20422236 1156..1248 465 100 Plus
Blast to na_te.dros performed 2019-03-16 10:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Uvir 6564 Dvir\Uvir VIRUVIR 6564bp 4513..4576 373..428 123 70.3 Plus
Bari1 1728 Bari1 DMBARI1 1728bp AKA(S55767) Derived from X67681 (g7640) (Rel. 36, Last updated, Version 6). 1386..1459 1439..1365 120 64 Minus

LD29815.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:48:26 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20415523..20416076 1..554 99 -> Plus
chr2L 20418737..20418830 555..648 98 -> Plus
chr2L 20418908..20419007 649..748 100 -> Plus
chr2L 20419066..20419252 749..935 100 -> Plus
chr2L 20419315..20419535 936..1156 100 -> Plus
chr2L 20420563..20420654 1157..1248 100 -> Plus
chr2L 20420720..20420829 1249..1358 100 -> Plus
chr2L 20420887..20421445 1359..1917 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:10:21 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 1..906 481..1386 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:01:54 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 1..906 481..1386 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:23:35 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 1..906 481..1386 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:32:23 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 1..906 481..1386 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:29 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 1..906 481..1386 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:49:58 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 54..1970 1..1917 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:01:54 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 54..1970 1..1917 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:23:35 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 54..1970 1..1917 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:32:23 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arc-p34-RA 54..1970 1..1917 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:29 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
Arpc2-RA 25..1941 1..1917 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:26 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20422145..20422236 1157..1248 100 -> Plus
2L 20422302..20422411 1249..1358 100 -> Plus
2L 20417114..20417667 1..554 100 -> Plus
2L 20420319..20420412 555..648 100 -> Plus
2L 20420490..20420589 649..748 100 -> Plus
2L 20420648..20420834 749..935 100 -> Plus
2L 20420897..20421117 936..1156 100 -> Plus
2L 20422469..20423027 1359..1917 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:26 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20422145..20422236 1157..1248 100 -> Plus
2L 20422302..20422411 1249..1358 100 -> Plus
2L 20417114..20417667 1..554 100 -> Plus
2L 20420319..20420412 555..648 100 -> Plus
2L 20420490..20420589 649..748 100 -> Plus
2L 20420648..20420834 749..935 100 -> Plus
2L 20420897..20421117 936..1156 100 -> Plus
2L 20422469..20423027 1359..1917 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:48:26 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20422145..20422236 1157..1248 100 -> Plus
2L 20422302..20422411 1249..1358 100 -> Plus
2L 20417114..20417667 1..554 100 -> Plus
2L 20420319..20420412 555..648 100 -> Plus
2L 20420490..20420589 649..748 100 -> Plus
2L 20420648..20420834 749..935 100 -> Plus
2L 20420897..20421117 936..1156 100 -> Plus
2L 20422469..20423027 1359..1917 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:23:35 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20417114..20417667 1..554 100 -> Plus
arm_2L 20420319..20420412 555..648 100 -> Plus
arm_2L 20420490..20420589 649..748 100 -> Plus
arm_2L 20420648..20420834 749..935 100 -> Plus
arm_2L 20420897..20421117 936..1156 100 -> Plus
arm_2L 20422145..20422236 1157..1248 100 -> Plus
arm_2L 20422302..20422411 1249..1358 100 -> Plus
arm_2L 20422469..20423027 1359..1917 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:09:03 Download gff for LD29815.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20417114..20417667 1..554 100 -> Plus
2L 20420319..20420412 555..648 100 -> Plus
2L 20420490..20420589 649..748 100 -> Plus
2L 20420648..20420834 749..935 100 -> Plus
2L 20420897..20421117 936..1156 100 -> Plus
2L 20422145..20422236 1157..1248 100 -> Plus
2L 20422302..20422411 1249..1358 100 -> Plus
2L 20422469..20423027 1359..1917 100   Plus

LD29815.pep Sequence

Translation from 480 to 1385

> LD29815.pep
MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNG
DKTKVRISISLKFYKQLQEHGADELLKREYGSLLTDTEEGYNVSVLINLE
EIPEDCEQIAKRIGLLKRNCFASVFEKYFDYQEQGEEGQKRAVINYRNDE
TLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTAPQVLF
SHREPPLELANTDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDY
LHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPEPKNTEKKTITGRTFKRI
D*

LD29815.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:51:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15118-PA 301 GF15118-PA 1..301 1..301 1578 98.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21231-PA 301 GG21231-PA 1..301 1..301 1586 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:51:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10132-PA 301 GH10132-PA 1..299 1..299 1540 97 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc2-PB 301 CG10954-PB 1..301 1..301 1554 100 Plus
Arpc2-PA 301 CG10954-PA 1..301 1..301 1554 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22182-PA 301 GI22182-PA 1..299 1..299 1510 95.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:51:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26606-PA 70 GL26606-PA 1..70 1..72 329 93.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:51:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10664-PA 301 GA10664-PA 1..301 1..301 1574 98 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23346-PA 301 GM23346-PA 1..301 1..301 1597 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:51:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24255-PA 301 GD24255-PA 1..301 1..301 1597 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20052-PA 147 GJ20052-PA 65..145 219..299 387 88.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:51:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18265-PA 301 GK18265-PA 1..299 1..299 1533 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:51:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Arc-p34-PA 301 GE13307-PA 1..301 1..301 1591 99.3 Plus

LD29815.hyp Sequence

Translation from 480 to 1385

> LD29815.hyp
MILLEINNRIIEETLLVKYRNAQAGLKPESIDIRIADFDGVLYHISNVNG
DKTKVRISISLKFYKQLQEHGADELLKREYGSLLTDTEEGYNVSVLINLE
EIPEDCEQIAKRIGLLKRNCFASVFEKYFDYQEQGEEGQKRAVINYRNDE
TLYVEAKPDRVTVVFSTIFRDEDDVIIGKVFMQELREGRRASHTAPQVLF
SHREPPLELANTDARVGDNIGYVTFVLFPRHTNKETRDNTINLIHMFRDY
LHYHIKCSKAYIHSRMRAKTSDFLKVLNRARPEPKNTEKKTITGRTFKRI
D*

LD29815.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Arpc2-PB 301 CG10954-PB 1..301 1..301 1554 100 Plus
Arpc2-PA 301 CG10954-PA 1..301 1..301 1554 100 Plus