Clone LD29885 Report

Search the DGRC for LD29885

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:298
Well:85
Vector:pOT2
Associated Gene/TranscriptepsilonCOP-RA
Protein status:LD29885.pep: gold
Preliminary Size:1318
Sequenced Size:1100

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9543 2000-02-14 Blastp of sequenced clone
CG9543 2001-01-01 Release 2 assignment
CG9543 2003-01-01 Sim4 clustering to Release 3
epsilonCOP 2008-04-29 Release 5.5 accounting
epsilonCOP 2008-08-15 Release 5.9 accounting
epsilonCOP 2008-12-18 5.12 accounting

Clone Sequence Records

LD29885.complete Sequence

1100 bp (1100 high quality bases) assembled on 2000-02-14

GenBank Submission: AF145691

> LD29885.complete
CGATAAGTTTACACAAATAAGCCAACTCAGCCGAAAAGAATTCGGTTTTT
CCATCTAATTCAATAATATTTACGAAAATGAGCCGACAGCAGAATGAGGA
GGACACCAACTCGGTGCTATTCGATGCCCGCAACGAGTACTACATCGGTA
ACTTCATGGGCTCGATCAACTTCGTGCTGCCGGAGCAGGGTACCGCGGGT
CCGGAGCTCCTGTCCTACATGTACCTATCTTACTTGGCCATCGATTCCGG
GCGCATCGTGGCCTCGGACATCAAGGAGGGAAACTCCACGCCACTGCAGG
CCTTGCGTCTGGTGCACGAAGCCTTTGAGCAGCCTTCGAGGACGGAGGAG
CTGCTGGAGAAACTCACGGACAAGGTGGCCGGAGAGGAGGATGAGACCAA
CATCTGGCACCTTGCAACCGCCATCGTCTACTGCCACGACGGGCAGTTCG
AGAACGCACTGAAGATCCTGCACGGCTCCACCAATCTGGAGTCGATGGCT
CTGTCGGTCCAGTGCCTGCTGCGTCTGCAGCGCGTGGACCTGGCCAAGCA
GCTGGTGGCCAAGATGCAGGAGATCAGCGACGATGCTACGCTGACTCAGC
TCGCTCAGGCGTGGGTGGCCCTCGCCCAGGGAACGGAACAGATGCAGGAC
GCCTTTCACATCTACCAGGAGTTCTGTGAAAAGTTCAAGCCAACTCCGGC
GCTGCTGAACGGCCAAGCGGTCGTTCATTTGGGTCTGGAGCGGTACGAGG
AGGCAGATTCCGTTCTGCGTGAATCTCTGCTGAAGAAGCACAACGACTAC
GACACGCTGATCAATCTGATGGTTCATGCCCATCTTACGGGCAAGCCGAC
AGAGGCGATCACCCGGAATCTAGAACAGCTGAGGCAGTTCTATCCCAAGA
GCGACTTTGTCACCGATCTAGACAAGAAGTCAGCGGAGTTCGACCGCCTG
TGCCTGCAGTACGACGTCGAGGGCGGTGAAAAACTGCTCGCCGTCTAGAT
ATAAGAAAAAATTCCAAATATCCAAATTAACAAAACCTTTTGTTCATGTA
TTAAACTACAATAAAAATTTATTAGAAATGTAAAAAAAAAAAAAAAAAAA

LD29885.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:41:50
Subject Length Description Subject Range Query Range Score Percent Strand
epsilonCOP-RA 1104 epsilonCOP-RA 23..1104 1..1082 5410 100 Plus
CG9548-RA 538 CG9548-RA 494..538 1082..1038 225 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 6488096..6489176 1..1081 5270 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:23:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:43:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6489114..6490195 1..1082 5410 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:02:51
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 6489114..6490195 1..1082 5410 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:43:10 has no hits.

LD29885.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:44:06 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 6488096..6489176 1..1081 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:10:32 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:34:43 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:30 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:10:22 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:40:58 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 1..921 78..998 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:37:19 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 23..1103 1..1081 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:34:43 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 23..1103 1..1081 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:30 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 25..1105 1..1081 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:10:22 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 23..1103 1..1081 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:40:58 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
epsilonCOP-RA 25..1105 1..1081 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:06 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6489114..6490194 1..1081 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:06 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6489114..6490194 1..1081 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:44:06 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6489114..6490194 1..1081 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:30 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 6489114..6490194 1..1081 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:46:55 Download gff for LD29885.complete
Subject Subject Range Query Range Percent Splice Strand
2L 6489114..6490194 1..1081 100   Plus

LD29885.pep Sequence

Translation from 77 to 997

> LD29885.pep
MSRQQNEEDTNSVLFDARNEYYIGNFMGSINFVLPEQGTAGPELLSYMYL
SYLAIDSGRIVASDIKEGNSTPLQALRLVHEAFEQPSRTEELLEKLTDKV
AGEEDETNIWHLATAIVYCHDGQFENALKILHGSTNLESMALSVQCLLRL
QRVDLAKQLVAKMQEISDDATLTQLAQAWVALAQGTEQMQDAFHIYQEFC
EKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHNDYDTLINLMVH
AHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQYDVEGG
EKLLAV*

LD29885.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 20:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14166-PA 306 GF14166-PA 1..306 1..306 1574 96.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 20:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10415-PA 306 GG10415-PA 1..306 1..306 1630 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 20:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13650-PA 306 GH13650-PA 1..306 1..306 1431 87.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
epsilonCOP-PA 306 CG9543-PA 1..306 1..306 1567 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 20:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13628-PA 307 GI13628-PA 1..307 1..306 1438 88 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 20:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25672-PA 307 GL25672-PA 1..307 1..306 1505 91.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 20:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21869-PA 307 GA21869-PA 1..307 1..306 1509 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 20:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18632-PA 306 GM18632-PA 1..306 1..306 1629 99.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 20:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23412-PA 306 GD23412-PA 1..306 1..306 1632 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 20:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18334-PA 306 GJ18334-PA 1..306 1..306 1453 89.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 20:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18724-PA 307 GK18724-PA 1..307 1..306 1426 86.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 20:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13901-PA 306 GE13901-PA 1..306 1..306 1625 99 Plus

LD29885.hyp Sequence

Translation from 77 to 997

> LD29885.hyp
MSRQQNEEDTNSVLFDARNEYYIGNFMGSINFVLPEQGTAGPELLSYMYL
SYLAIDSGRIVASDIKEGNSTPLQALRLVHEAFEQPSRTEELLEKLTDKV
AGEEDETNIWHLATAIVYCHDGQFENALKILHGSTNLESMALSVQCLLRL
QRVDLAKQLVAKMQEISDDATLTQLAQAWVALAQGTEQMQDAFHIYQEFC
EKFKPTPALLNGQAVVHLGLERYEEADSVLRESLLKKHNDYDTLINLMVH
AHLTGKPTEAITRNLEQLRQFYPKSDFVTDLDKKSAEFDRLCLQYDVEGG
EKLLAV*

LD29885.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:38
Subject Length Description Subject Range Query Range Score Percent Strand
epsilonCOP-PA 306 CG9543-PA 1..306 1..306 1567 100 Plus