Clone LD30049 Report

Search the DGRC for LD30049

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:300
Well:49
Vector:pOT2
Associated Gene/TranscriptCG5704-RA
Protein status:LD30049.pep: gold
Preliminary Size:1387
Sequenced Size:1210

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5704 2001-01-01 Release 2 assignment
CG5704 2002-05-15 Blastp of sequenced clone
CG5704 2003-01-01 Sim4 clustering to Release 3
CG5704 2008-04-29 Release 5.5 accounting
CG5704 2008-08-15 Release 5.9 accounting
CG5704 2008-12-18 5.12 accounting

Clone Sequence Records

LD30049.complete Sequence

1210 bp (1210 high quality bases) assembled on 2002-05-15

GenBank Submission: AY118547

> LD30049.complete
AGAAAGACGAGTAGACAATCAAACGGAATACAAATGATTTAGAGCAAATT
AAGATAAGCAAAAACCAGTACTACTTAAATCGAGAATTAAGAGCAATGGG
AACTTTGTCACTGAGCGATTTCGAAGCTGTGAAGATTCCCGTACCCTGGG
GTCACATTTCTGGACGTTGGTACGGAAATCGGAACGAGCGACCCATCTTG
GCGATTCACGGATGGCTGGACAACCTGGGAACCTTCGATCGGCTCATTCC
CCTGCTTCCTGACTATCTAGGAGTACTCTGCATCGATCTGCCAGGACATG
GAAGATCCTCGCATTTGCCACCGGGAATGTACTACAGTGTGTACGAGTAC
GTGTTCACTATTCCACTGGTCATGAAGGAGTACGGATGGTCAAAGGTCTC
TCTCATTGGACACTCACTGGGCGGAGTCCTGAGCTTCATTTATGCCTCTC
TTGCTCCTCACACCGTCGATATGATCGTCTCCCTGGACATACTGCTCCCC
TTGAGAAACGACATAGACTACATGGACCTTAGTATAGAGAAACAACTAGT
GAATGTTGAGCGACAGAAGCTGGGAAATTACATTGAGCCGCCCTCCTACA
CGCACAACCAATTGGGAAAGGTGCTGGCTGCGGGAAGCTTTAATTCCGTA
TCCCCCGAACTGGCTAAGCACCTCCTCCACCGCCAGTTGGCCAAGTCGAA
ACTGTATCCCGAACGGTTCTATTTCACTAGGGATATTCGAGTAAAGTACT
ACCACTACATAGATATCGACGATAGTCTGGGGGCAGAAATGGCGAGGCGG
ATCATTAAAAAGCCATATCTAATCATCAAGGGCTCCTTGTCACCATATCT
CTCCGTCCGCAACAACGAGGCTATATCGATTTTGGCCAAGGATAATCCGC
ACTTTGAGTTCTACGAGGTGGAAAACGGCACCCATCATCTGCATCTCCAT
GCCGCCGAGGAATGCGCCGGTTACATTGTGCCCTTCATCCAACATCACAG
ACCTCCTGCTATGACCTCCTGGACTGTGGCCGGAAAGGAAGATAGATCGA
GAAAACCAAAGCGATTTTTCACATGGACCAACAAAAAGCGCAGCAAGTTG
TGATAATAATACACTGTAACTTTAGTTGTAAAGGTTTTAAAGTTTGAGAA
CGTGAACACACGACAAGTATTAAATTTAAACTATCATATTAAAAAAAAAA
AAAAAAAAAA

LD30049.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:08:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG5704-RA 1633 CG5704-RA 292..1484 1..1193 5965 100 Plus
CG15879.a 1469 CG15879.a 211..618 96..503 720 78.4 Plus
CG15879-RA 1469 CG15879-RA 211..618 96..503 720 78.4 Plus
CG15879.a 1469 CG15879.a 1021..1130 894..1003 250 81.8 Plus
CG15879-RA 1469 CG15879-RA 1021..1130 894..1003 250 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:37:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 2169077..2170147 1190..120 5025 97.9 Minus
chr3L 24539361 chr3L 2167852..2168212 503..143 680 79.2 Minus
chr3L 24539361 chr3L 2173107..2173417 439..129 550 78.5 Minus
chr3L 24539361 chr3L 2170277..2170394 119..1 530 98.3 Minus
chr3L 24539361 chr3L 2171843..2172136 423..130 495 77.9 Minus
chr3L 24539361 chr3L 2172537..2172680 1006..863 270 79.2 Minus
chr3L 24539361 chr3L 2167337..2167449 1006..894 265 82.3 Minus
chr3L 24539361 chr3L 2171333..2171391 937..879 250 94.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed 2010-04-22 19:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
CR15821-RA 888 CR15821-RA 38..164 130..256 260 80.3 Plus
CR15821-RA 888 CR15821-RA 727..785 879..937 235 93.2 Plus
CR15821-RA 888 CR15821-RA 178..236 270..328 205 89.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:37:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 2169619..2170692 1193..120 5370 100 Minus
3L 28110227 3L 2168401..2168761 503..143 680 79.2 Minus
3L 28110227 3L 2170823..2170941 119..1 595 100 Minus
3L 28110227 3L 2173650..2173960 439..129 520 77.8 Minus
3L 28110227 3L 2172387..2172680 423..130 480 77.6 Minus
3L 28110227 3L 2173080..2173195 1006..891 265 81.9 Minus
3L 28110227 3L 2167889..2167998 1003..894 250 81.8 Minus
3L 28110227 3L 2171880..2171938 937..879 235 93.2 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 2169619..2170692 1193..120 5370 100 Minus
3L 28103327 3L 2168401..2168761 503..143 680 79.2 Minus
3L 28103327 3L 2170823..2170941 119..1 595 100 Minus
3L 28103327 3L 2173782..2173960 307..129 445 83.2 Minus
3L 28103327 3L 2173080..2173195 1006..891 265 81.8 Minus
3L 28103327 3L 2172554..2172680 256..130 260 80.3 Minus
3L 28103327 3L 2167889..2167998 1003..894 250 81.8 Minus
3L 28103327 3L 2171880..2171938 937..879 235 93.2 Minus
3L 28103327 3L 2172482..2172540 328..270 205 89.8 Minus
Blast to na_te.dros performed on 2019-03-16 16:37:01 has no hits.

LD30049.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:37:55 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 2169077..2170147 120..1190 97 <- Minus
chr3L 2170277..2170394 1..119 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:10:48 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 1..1008 96..1103 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:51:20 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 1..1008 96..1103 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:18 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 1..1008 96..1103 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:43:57 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 1..1008 96..1103 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:35:57 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 1..1008 96..1103 100   Plus
Sim4 to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:23:30 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:29:07 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 14..1203 1..1190 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:51:20 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 1..1190 1..1190 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:18 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 31..1220 1..1190 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:43:57 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 14..1203 1..1190 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:35:57 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
CG5704-RA 31..1220 1..1190 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:37:55 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2169622..2170692 120..1190 100 <- Minus
3L 2170823..2170941 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:37:55 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2169622..2170692 120..1190 100 <- Minus
3L 2170823..2170941 1..119 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:37:55 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2169622..2170692 120..1190 100 <- Minus
3L 2170823..2170941 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:18 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 2169622..2170692 120..1190 100 <- Minus
arm_3L 2170823..2170941 1..119 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:16:16 Download gff for LD30049.complete
Subject Subject Range Query Range Percent Splice Strand
3L 2169622..2170692 120..1190 100 <- Minus
3L 2170823..2170941 1..119 100   Minus

LD30049.pep Sequence

Translation from 95 to 1102

> LD30049.pep
MGTLSLSDFEAVKIPVPWGHISGRWYGNRNERPILAIHGWLDNLGTFDRL
IPLLPDYLGVLCIDLPGHGRSSHLPPGMYYSVYEYVFTIPLVMKEYGWSK
VSLIGHSLGGVLSFIYASLAPHTVDMIVSLDILLPLRNDIDYMDLSIEKQ
LVNVERQKLGNYIEPPSYTHNQLGKVLAAGSFNSVSPELAKHLLHRQLAK
SKLYPERFYFTRDIRVKYYHYIDIDDSLGAEMARRIIKKPYLIIKGSLSP
YLSVRNNEAISILAKDNPHFEFYEVENGTHHLHLHAAEECAGYIVPFIQH
HRPPAMTSWTVAGKEDRSRKPKRFFTWTNKKRSKL*

LD30049.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 23:35:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24932-PA 342 GF24932-PA 1..342 1..335 1285 70.8 Plus
Dana\GF24933-PA 344 GF24933-PA 1..344 1..335 1214 65.9 Plus
Dana\GF24931-PA 315 GF24931-PA 8..298 12..302 977 62 Plus
Dana\GF24930-PA 362 GF24930-PA 22..332 12..318 802 50 Plus
Dana\GF24201-PA 348 GF24201-PA 35..347 9..320 646 41.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 23:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14531-PA 335 GG14531-PA 1..335 1..335 1651 91.3 Plus
Dere\GG14532-PA 344 GG14532-PA 1..344 1..335 1186 64.3 Plus
Dere\GG14530-PA 314 GG14530-PA 14..309 10..304 1091 68.2 Plus
Dere\GG14529-PA 357 GG14529-PA 22..329 12..316 763 49.8 Plus
Dere\GG13244-PA 349 GG13244-PA 36..348 9..320 656 43.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 23:35:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16488-PA 343 GH16488-PA 1..343 1..335 1029 58.7 Plus
Dgri\GH23210-PA 318 GH23210-PA 1..307 1..305 864 55.8 Plus
Dgri\GH16489-PA 318 GH16489-PA 1..307 1..305 864 55.8 Plus
Dgri\GH16485-PA 353 GH16485-PA 23..329 12..315 807 50.6 Plus
Dgri\GH16159-PA 359 GH16159-PA 39..341 2..303 651 43.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:11:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG5704-PB 335 CG5704-PB 1..335 1..335 1791 100 Plus
CG5704-PA 335 CG5704-PA 1..335 1..335 1791 100 Plus
CG15879-PA 342 CG15879-PA 1..342 4..335 1212 65.2 Plus
CG15820-PA 308 CG15820-PA 7..303 9..304 1096 68.4 Plus
CG5707-PA 357 CG5707-PA 22..329 12..316 799 49.2 Plus
CG5707-PC 361 CG5707-PC 26..333 12..316 799 49.2 Plus
CG5707-PB 361 CG5707-PB 26..333 12..316 799 49.2 Plus
CG11309-PF 348 CG11309-PF 35..347 9..320 663 43.1 Plus
CG11309-PE 348 CG11309-PE 35..347 9..320 663 43.1 Plus
CG11309-PD 348 CG11309-PD 35..347 9..320 663 43.1 Plus
CG11309-PC 348 CG11309-PC 35..347 9..320 663 43.1 Plus
CG11309-PB 348 CG11309-PB 35..347 9..320 663 43.1 Plus
CG11309-PA 358 CG11309-PA 45..357 9..320 663 43.1 Plus
CG7632-PB 312 CG7632-PB 13..311 6..303 617 44.1 Plus
CG7632-PA 330 CG7632-PA 34..329 9..303 613 44.2 Plus
kraken-PB 331 CG3943-PB 34..329 4..299 398 31.8 Plus
kraken-PA 331 CG3943-PA 34..329 4..299 398 31.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 23:35:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12160-PA 342 GI12160-PA 1..342 1..335 1109 62.4 Plus
Dmoj\GI12161-PA 343 GI12161-PA 1..343 1..335 967 54.2 Plus
Dmoj\GI12158-PA 395 GI12158-PA 61..376 12..324 798 48.6 Plus
Dmoj\GI13311-PA 352 GI13311-PA 39..334 9..303 626 43.2 Plus
Dmoj\GI12011-PA 336 GI12011-PA 40..335 9..303 594 43 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 23:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24626-PA 348 GL24626-PA 1..348 1..335 1228 65.5 Plus
Dper\GL24627-PA 331 GL24627-PA 1..324 1..322 1016 59.6 Plus
Dper\GL24589-PA 348 GL24589-PA 35..347 9..320 647 41.8 Plus
Dper\GL24680-PA 330 GL24680-PA 34..329 9..303 601 42 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 23:35:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23367-PA 348 GA23367-PA 1..348 1..335 1236 66.1 Plus
Dpse\GA23368-PA 332 GA23368-PA 1..326 1..324 998 58.4 Plus
Dpse\GA19073-PA 365 GA19073-PA 29..335 12..315 789 48.7 Plus
Dpse\GA10906-PA 348 GA10906-PA 35..347 9..320 647 41.8 Plus
Dpse\GA20494-PA 330 GA20494-PA 34..329 9..303 600 42 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 23:35:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14138-PA 293 GM14138-PA 1..270 1..270 1330 93.7 Plus
Dsec\GM14139-PA 345 GM14139-PA 1..345 1..335 1230 65.8 Plus
Dsec\GM14136-PA 308 GM14136-PA 7..303 9..304 1076 67.3 Plus
Dsec\GM14137-PA 323 GM14137-PA 15..314 10..305 959 59 Plus
Dsec\GM26924-PA 355 GM22149-PA 37..354 4..320 660 42.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 23:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13408-PA 335 GD13408-PA 1..335 1..335 1647 92.8 Plus
Dsim\GD13410-PA 345 GD13410-PA 1..345 1..335 1230 65.5 Plus
Dsim\GD13406-PA 308 GD13406-PA 6..303 8..304 1086 67.8 Plus
Dsim\GD13407-PA 319 GD13407-PA 2..310 1..305 969 58.3 Plus
Dsim\GD13405-PA 357 GD13405-PA 22..329 12..316 767 49.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 23:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11632-PA 343 GJ11632-PA 1..343 1..335 1099 61.6 Plus
Dvir\GJ13440-PA 343 GJ13440-PA 1..343 1..335 1033 59 Plus
Dvir\GJ13439-PA 340 GJ13439-PA 1..331 1..329 1007 58.7 Plus
Dvir\GJ13437-PA 357 GJ13437-PA 23..338 12..324 805 49.8 Plus
Dvir\GJ12081-PA 357 GJ12081-PA 44..339 9..303 655 44.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 23:35:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12602-PA 346 GK12602-PA 1..346 1..335 1122 61.4 Plus
Dwil\GK12598-PA 358 GK12598-PA 21..323 12..311 761 50.7 Plus
Dwil\GK20424-PA 352 GK20424-PA 31..333 2..303 648 43.2 Plus
Dwil\GK20467-PA 335 GK20467-PA 39..334 9..303 596 43.3 Plus
Dwil\GK24439-PA 338 GK24439-PA 33..335 2..298 428 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 23:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20883-PA 335 GE20883-PA 1..335 1..335 1635 91 Plus
Dyak\GE20884-PA 341 GE20884-PA 1..317 4..317 1165 68.2 Plus
Dyak\GE20881-PA 314 GE20881-PA 1..309 1..304 1094 66.3 Plus
Dyak\GE20882-PA 319 GE20882-PA 2..313 1..308 977 58 Plus
Dyak\GE20878-PA 357 GE20878-PA 22..329 12..316 764 50.2 Plus

LD30049.hyp Sequence

Translation from 95 to 1102

> LD30049.hyp
MGTLSLSDFEAVKIPVPWGHISGRWYGNRNERPILAIHGWLDNLGTFDRL
IPLLPDYLGVLCIDLPGHGRSSHLPPGMYYSVYEYVFTIPLVMKEYGWSK
VSLIGHSLGGVLSFIYASLAPHTVDMIVSLDILLPLRNDIDYMDLSIEKQ
LVNVERQKLGNYIEPPSYTHNQLGKVLAAGSFNSVSPELAKHLLHRQLAK
SKLYPERFYFTRDIRVKYYHYIDIDDSLGAEMARRIIKKPYLIIKGSLSP
YLSVRNNEAISILAKDNPHFEFYEVENGTHHLHLHAAEECAGYIVPFIQH
HRPPAMTSWTVAGKEDRSRKPKRFFTWTNKKRSKL*

LD30049.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:34:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG5704-PB 335 CG5704-PB 1..335 1..335 1791 100 Plus
CG5704-PA 335 CG5704-PA 1..335 1..335 1791 100 Plus
CG15879-PA 342 CG15879-PA 1..342 4..335 1212 65.2 Plus
CG15820-PA 308 CG15820-PA 7..303 9..304 1096 68.4 Plus
CG5707-PA 357 CG5707-PA 22..329 12..316 799 49.2 Plus