Clone LD30122 Report

Search the DGRC for LD30122

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:301
Well:22
Vector:pOT2
Associated Gene/TranscriptVap-33A-RB
Protein status:LD30122.pep: gold
Preliminary Size:2321
Sequenced Size:2000

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5014 2001-09-19 Blastp of sequenced clone
CG5014 2003-01-01 Sim4 clustering to Release 3
Vap-33-1 2008-04-29 Release 5.5 accounting
Vap-33-1 2008-08-15 Release 5.9 accounting
Vap-33-1 2008-12-18 5.12 accounting

Clone Sequence Records

LD30122.complete Sequence

2000 bp (2000 high quality bases) assembled on 2001-09-19

GenBank Submission: AY060395

> LD30122.complete
GAATATATGGCTTTTTTACATTTTGCGTTTTCAACTGAAGTTTGCGAAGA
AACCGAAGCGTGGTAAACCACTGAAATCGAAAATATCGACAGAAAAGCGA
CCTAAAGTCGGTGAAGAAGTCGCACGTTGATCGTTGTGTTTTTTTCCCGA
AATTTTCTGCAAAAAGCCCGTGCGTGCGTGAGTTTCTCTGGCTCTTGCTT
TTTTTTTGTCCATGCGTGTGTGTGTGGTCGCATAAATTTACCGATATTTC
GCCTGTGAGAGCGAAACGAACGAAAAACGAAAGAAAAAAAGAGAGACGAG
TAAAGTAAAACGAAACAGGCATAAAAACAGCAGCAGTTTTCTTGATATAT
TTGGCTAAAAAACGCAAACCAAACAGCCAGCAAGAACAACAAATAGCTGG
GCAAAAACAGGACGCACAAAAAATAAAATTAAAACGATAAGAGGCGAAAA
GCGGAGAGAGTGAAATTCTCGGCAGCAACAACGACAAGAACAACACCAGG
AGCAGCAGCAACAACAACAACAAAAGCCAGCCGCCACAATGAGCAAATCA
CTCTTTGATCTTCCGTTGACCATTGAACCAGAACATGAGTTGCGTTTTGT
GGGTCCCTTCACCCGACCCGTTGTCACAATCATGACTCTGCGCAACAACT
CGGCTCTGCCTCTGGTCTTCAAGATCAAGACAACCGCCCCGAAACGCTAC
TGCGTACGTCCAAACATCGGCAAGATAATTCCCTTTCGATCAACCCAGGT
GGAGATCTGCCTTCAGCCATTCGTCTACGATCAGCAGGAGAAGAACAAGC
ACAAGTTCATGGTGCAGAGCGTCCTGGCACCCATGGATGCTGATCTAAGC
GATTTAAATAAATTGTGGAAGGATCTGGAGCCCGAGCAGCTGATGGACGC
CAAACTGAAGTGCGTTTTCGAGATGCCCACCGCTGAGGCAAATGCTGAGA
ACACCAGCGGTGGTGGTGCCGTTGGCGGCGGAACCGGAGCTGCCGGAGGC
GGAAGCGCGGGTGCCAATACTAGCTCAGCCAGCGCTGAGGCGCTCGAGAG
CAAGCCGAAGCTCTCCAGCGAGGATAAGTTTAAGCCATCCAATTTGCTCG
AAACGTCTGAGAGTCTGGACTTGCTGTCCGGAGAGATCAAAGCGCTGCGT
GAATGCAACATTGAATTGCGAAGAGAGAATCTTCACTTGAAGGATCAAAT
CACACGTTTCCGGAGCTCGCCGGCCGTCAAACAGGTGAATGAGCCCTATG
CCCCAGTCCTGGCTGAGAAGCAGATTCCGGTCTTTTACATTGCAGTTGCC
ATTGCTGCGGCCATCGTTAGCCTCCTGCTGGGCAAATTCTTTCTCTGAAT
GCCATAAACGAACGCCAGCAACATGCTACATGCAACGTGCAGCAACAGTA
ACAGCAAGAACAGCGGCAACACCATCATACAGCAACAGCAACAACAAAAG
CAAAAGCAGCAGCAGCAGCAGCAACTAACAATAGCAACAACAACGAAAGA
AGAACAGCAGCAGCAGGAGCATTAAAATAAATTTAATTGGCAGAAGAAAC
AAACCACAGAGACGAATGTAAAGCTGACTAAACCGGGGACCGTATACATT
TAAACGGTTGTATTGAAAATCAAAAATAATCATTGTTTGTTAGCGAAACA
AGTATCGCTCAGAATAGTATGGATTATGATGTGAGAAATATTGTTTGGTT
CCAACATATTGCTCAAAGACAGATTGGCAGTTCTTGTTTTTAATACGAAT
CTTAACGAGACTTAAGTGTAAAGCATTCGAAACAATTTTAAGCTGTATTG
ACGCTTCGTGTATTTCAACCAAAAATATTTAAGTTTTTGCAAGATCTCGC
TTGAATTAGTCGCAACCGGACTTTGAGTAATAAGAACATTTGGGCCCTAT
GAAATCCCTCACATCATAATCAATACTTAAAAAAAAGAAAACATAACGAA
TGATTACTTTTGGTACCTGGGCTAAACAAAACAAAAAAAAAAAAAAAAAA

LD30122.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Vap-33-1.q 3567 Vap-33-1.q 77..2076 1..2000 10000 100 Plus
Vap-33-1-RB 2607 Vap-33-1-RB 77..2076 1..2000 10000 100 Plus
Vap-33-1.o 2878 Vap-33-1.o 77..2076 1..2000 10000 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 3846089..3846878 1187..1982 3825 99 Plus
chrX 22417052 chrX 3842327..3842698 1..369 1780 99.2 Plus
chrX 22417052 chrX 3842807..3843044 370..604 1095 98.3 Plus
chrX 22417052 chrX 3845156..3845369 865..1078 1070 100 Plus
chrX 22417052 chrX 3844742..3844895 602..755 770 100 Plus
chrX 22417052 chrX 3845434..3845550 1077..1193 585 100 Plus
chrX 22417052 chrX 3844964..3845073 756..865 550 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:23:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 3952761..3953574 1187..2000 4055 99.9 Plus
X 23542271 X 3949004..3949372 1..369 1845 100 Plus
X 23542271 X 3949481..3949715 370..604 1175 100 Plus
X 23542271 X 3951828..3952041 865..1078 1070 100 Plus
X 23542271 X 3951414..3951567 602..755 770 100 Plus
X 23542271 X 3952106..3952222 1077..1193 585 100 Plus
X 23542271 X 3951636..3951745 756..865 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:42:05
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 3960859..3961672 1187..2000 4055 99.8 Plus
X 23527363 X 3957102..3957470 1..369 1845 100 Plus
X 23527363 X 3957579..3957813 370..604 1175 100 Plus
X 23527363 X 3959926..3960139 865..1078 1070 100 Plus
X 23527363 X 3959512..3959665 602..755 770 100 Plus
X 23527363 X 3960204..3960320 1077..1193 585 100 Plus
X 23527363 X 3959734..3959843 756..865 550 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:58:44 has no hits.

LD30122.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:59:26 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 3842327..3842698 1..369 99 -> Plus
chrX 3842807..3842909 370..472 99 == Plus
chrX 3842964..3843042 524..602 100 -> Plus
chrX 3844743..3844895 603..755 100 -> Plus
chrX 3844964..3845073 756..865 100 -> Plus
chrX 3845157..3845369 866..1078 100 -> Plus
chrX 3845436..3845549 1079..1192 100 -> Plus
chrX 3846095..3846291 1193..1389 100 == Plus
chrX 3846393..3846869 1497..1973 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:10:52 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RC 1..810 539..1348 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:01:45 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RC 1..810 539..1348 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:23:52 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 1..810 539..1348 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:32:15 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RC 1..810 539..1348 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:42 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33A-RB 1..810 539..1348 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:49:46 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 29..2010 1..1982 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:01:45 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 29..2010 1..1982 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:23:52 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 30..2011 1..1982 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:32:15 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33-1-RB 29..2010 1..1982 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:42 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
Vap-33A-RB 30..2011 1..1982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:26 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
X 3949004..3949372 1..369 100 -> Plus
X 3949481..3949713 370..602 100 -> Plus
X 3951415..3951567 603..755 100 -> Plus
X 3951636..3951745 756..865 100 -> Plus
X 3951829..3952041 866..1078 100 -> Plus
X 3952108..3952221 1079..1192 100 -> Plus
X 3952767..3953556 1193..1982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:26 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
X 3949004..3949372 1..369 100 -> Plus
X 3949481..3949713 370..602 100 -> Plus
X 3951415..3951567 603..755 100 -> Plus
X 3951636..3951745 756..865 100 -> Plus
X 3951829..3952041 866..1078 100 -> Plus
X 3952108..3952221 1079..1192 100 -> Plus
X 3952767..3953556 1193..1982 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:26 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
X 3949004..3949372 1..369 100 -> Plus
X 3949481..3949713 370..602 100 -> Plus
X 3951415..3951567 603..755 100 -> Plus
X 3951636..3951745 756..865 100 -> Plus
X 3951829..3952041 866..1078 100 -> Plus
X 3952108..3952221 1079..1192 100 -> Plus
X 3952767..3953556 1193..1982 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:23:52 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 3843037..3843405 1..369 100 -> Plus
arm_X 3843514..3843746 370..602 100 -> Plus
arm_X 3845448..3845600 603..755 100 -> Plus
arm_X 3845669..3845778 756..865 100 -> Plus
arm_X 3845862..3846074 866..1078 100 -> Plus
arm_X 3846141..3846254 1079..1192 100 -> Plus
arm_X 3846800..3847589 1193..1982 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:08:52 Download gff for LD30122.complete
Subject Subject Range Query Range Percent Splice Strand
X 3959734..3959843 756..865 100 -> Plus
X 3957102..3957470 1..369 100 -> Plus
X 3957579..3957811 370..602 100 -> Plus
X 3959513..3959665 603..755 100 -> Plus
X 3959927..3960139 866..1078 100 -> Plus
X 3960206..3960319 1079..1192 100 -> Plus
X 3960865..3961654 1193..1982 100   Plus

LD30122.hyp Sequence

Translation from 538 to 1347

> LD30122.hyp
MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTA
PKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMD
ADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENTSGGGAVGGGTG
AAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEI
KALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQIPVFY
IAVAIAAAIVSLLLGKFFL*

LD30122.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:45
Subject Length Description Subject Range Query Range Score Percent Strand
Vap-33A-PE 269 CG5014-PE 1..269 1..269 1362 100 Plus
Vap-33A-PC 269 CG5014-PC 1..269 1..269 1362 100 Plus
Vap-33A-PB 269 CG5014-PB 1..269 1..269 1362 100 Plus
Vap-33A-PA 235 CG5014-PA 1..235 1..269 1148 87.4 Plus
fan-PA 218 CG7919-PA 9..140 10..145 210 35 Plus

LD30122.pep Sequence

Translation from 538 to 1347

> LD30122.pep
MSKSLFDLPLTIEPEHELRFVGPFTRPVVTIMTLRNNSALPLVFKIKTTA
PKRYCVRPNIGKIIPFRSTQVEICLQPFVYDQQEKNKHKFMVQSVLAPMD
ADLSDLNKLWKDLEPEQLMDAKLKCVFEMPTAEANAENTSGGGAVGGGTG
AAGGGSAGANTSSASAEALESKPKLSSEDKFKPSNLLETSESLDLLSGEI
KALRECNIELRRENLHLKDQITRFRSSPAVKQVNEPYAPVLAEKQIPVFY
IAVAIAAAIVSLLLGKFFL*

LD30122.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22260-PA 276 GF22260-PA 1..257 1..250 939 73.9 Plus
Dana\GF23956-PA 227 GF23956-PA 6..191 10..211 239 34 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18683-PA 273 GG18683-PA 1..273 1..269 1127 85.1 Plus
Dere\GG14468-PA 232 GG14468-PA 9..232 10..269 218 27.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24467-PA 269 GH24467-PA 7..250 6..250 883 70.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
Vap33-PE 269 CG5014-PE 1..269 1..269 1362 100 Plus
Vap33-PC 269 CG5014-PC 1..269 1..269 1362 100 Plus
Vap33-PB 269 CG5014-PB 1..269 1..269 1362 100 Plus
Vap33-PA 235 CG5014-PA 1..235 1..269 1148 87.4 Plus
fan-PA 218 CG7919-PA 9..140 10..145 210 35 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16484-PA 269 GI16484-PA 7..269 6..269 841 67.9 Plus
Dmoj\GI13153-PA 220 GI13153-PA 2..115 10..125 183 35.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14766-PA 263 GL14766-PA 1..244 1..250 914 72 Plus
Dper\GL24786-PA 201 GL24786-PA 1..196 1..245 481 47.8 Plus
Dper\GL26519-PA 249 GL26519-PA 1..237 1..267 170 24.9 Plus
Dper\GL25412-PA 240 GL25412-PA 1..141 1..142 160 25.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:49:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18596-PA 263 GA18596-PA 1..244 1..250 914 72 Plus
Dpse\GA28912-PA 220 GA28912-PA 1..219 1..268 525 46.3 Plus
Dpse\GA28892-PA 249 GA28892-PA 1..237 1..267 175 25.7 Plus
Dpse\GA28611-PA 240 GA28611-PA 1..141 1..142 160 25.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:49:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12317-PA 251 GM12317-PA 1..251 1..269 1038 87.7 Plus
Dsec\GM25016-PA 218 GM25016-PA 9..190 10..208 227 30.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16666-PA 235 GD16666-PA 1..235 1..269 1055 81.4 Plus
Dsim\GD14051-PA 218 GD14051-PA 9..187 10..205 226 30.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:49:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16028-PA 267 GJ16028-PA 7..248 6..250 859 69.1 Plus
Dvir\GJ11927-PA 228 GJ11927-PA 1..123 1..124 180 33.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:49:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10259-PA 237 GK10259-PA 1..224 1..227 835 72.7 Plus
Dwil\GK19945-PA 199 GK19945-PA 1..97 46..142 168 37.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16322-PA 269 GE16322-PA 6..269 5..269 1069 84.2 Plus
Dyak\fan-PA 229 GE21656-PA 9..224 10..268 229 28.1 Plus