Clone LD30246 Report

Search the DGRC for LD30246

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:302
Well:46
Vector:pOT2
Associated Gene/TranscriptCG12200-RA
Protein status:LD30246.pep: gold
Preliminary Size:1103
Sequenced Size:947

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12200 2001-01-01 Release 2 assignment
CG12200 2003-01-01 Sim4 clustering to Release 3
CG12200 2003-01-14 Blastp of sequenced clone
CG12200 2008-04-29 Release 5.5 accounting
CG12200 2008-08-15 Release 5.9 accounting
CG12200 2008-12-18 5.12 accounting

Clone Sequence Records

LD30246.complete Sequence

947 bp (947 high quality bases) assembled on 2003-01-14

GenBank Submission: AY051777

> LD30246.complete
AAAACTTGCAAGGCGAGGAAAAAAACATATATTGGTCACTATGTTTCGAG
TGCATTGCAACAAGTGTTTCCGTCATCGCAAAACTGATCCAGCCGTGCCC
TTCCACTTGACCCAGTGCCGGCACGTGATCTGCGGCCCCTGTTTGGGCCA
ATCCTCGCTAGAAAAGAACTGCCCGCTATGCGGCCAGGTGCTCAAAGCGA
TCCAGATCAACCGGGATATGCCAACTAGCGTGGCCAACTACTTCGCGGAT
CCCCTGCGATTCCAGCAGATCTACCGCAAGATCTCCAAGTTCCAAGCGGA
CCAGCGAGCATCGGACAACCTGGGTTTCTACCGTCAGTTGCAGCAGCTGG
AGCAAAACAAGCGCCAGCTGGAGGGCTTTTGCAAGATGGAGGCGCAGCTG
AACCAGAAGGTCGTGGAGGAAAAGAAGCGAATCGCTGAATTGCGCACCTA
CATCGCTTACCACGAGAATGCGCAGAGGATGACGAGGCGCCGGCACAGTG
CAGGTGAGAGATTCCATACGCCGGAGTTCAAGGAGGCCTGGAACACCTCT
ATCAGCACTTCGGACAAATCGCCGTCGGATATGCCTTCTGATAGCTCCCG
CCGGTCCGCGGACTTGGATACCCAGTCAACGCGGAGAAGATCTTTTGGCA
GCGACACTAAAGGCTTTCGTCTTTAGTCACTCCAATTACTTGTATAATTT
TTTATAGGAATTCTAAGACTATAACCACTTCTAACGATTCAATTAGGTTT
TGACCTTCCAGAAGATTCCCAATATAAAGAACCAGATAGATTATTAAGTT
GCGCTTAAGGTACTAATTATCATCCGTATTCTATTACTATTACTATTCAA
ATCGAGACGTTCCACTACTCATGTGCGGGATATGATAACCATAAACGGAA
ATATAACAATCTACTTTAGCTTACAAAACAAAAAAAAAAAAAAAAAA

LD30246.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:26:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG12200-RA 928 CG12200-RA 1..928 1..928 4640 100 Plus
CG31053-RA 820 CG31053-RA 207..431 229..453 450 80 Plus
nc_19648.a 879 nc_19648.a 518..742 453..229 450 80 Minus
CG31053-RA 820 CG31053-RA 78..159 100..181 170 80.4 Plus
nc_19648.a 879 nc_19648.a 790..871 181..100 170 80.4 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:06:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19363905..19364833 1..929 4555 99.4 Plus
chr3R 27901430 chr3R 23750702..23751114 453..41 535 75.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:23:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:06:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19475127..19476062 1..936 4650 99.8 Plus
3R 32079331 3R 27927744..27928156 453..41 535 75.3 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:03:34
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19483225..19484160 1..936 4650 99.7 Plus
3R 31820162 3R 27668575..27668799 453..229 450 80 Minus
3R 31820162 3R 27668847..27668928 181..100 170 80.4 Minus
Blast to na_te.dros performed on 2019-03-16 01:06:36 has no hits.

LD30246.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:07:30 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19363905..19364833 1..929 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:11:00 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..636 41..676 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:57:02 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..636 41..676 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:09 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..636 41..676 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:47:54 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..636 41..676 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:23:18 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..636 41..676 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:12:59 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..928 1..928 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:57:01 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..929 1..929 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:09 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 65..993 1..929 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:47:54 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 1..928 1..928 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:23:18 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
CG12200-RA 65..993 1..929 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:30 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
X 19475127..19476055 1..929 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:30 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
X 19475127..19476055 1..929 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:07:30 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
X 19475127..19476055 1..929 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:09 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19369160..19370088 1..929 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:19:12 Download gff for LD30246.complete
Subject Subject Range Query Range Percent Splice Strand
X 19483225..19484153 1..929 100   Plus

LD30246.hyp Sequence

Translation from 0 to 675

> LD30246.hyp
KLARRGKKHILVTMFRVHCNKCFRHRKTDPAVPFHLTQCRHVICGPCLGQ
SSLEKNCPLCGQVLKAIQINRDMPTSVANYFADPLRFQQIYRKISKFQAD
QRASDNLGFYRQLQQLEQNKRQLEGFCKMEAQLNQKVVEEKKRIAELRTY
IAYHENAQRMTRRRHSAGERFHTPEFKEAWNTSISTSDKSPSDMPSDSSR
RSADLDTQSTRRRSFGSDTKGFRL*

LD30246.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG12200-PA 211 CG12200-PA 1..211 14..224 1122 100 Plus
CG31053-PA 219 CG31053-PA 1..219 14..224 555 50 Plus

LD30246.pep Sequence

Translation from 40 to 675

> LD30246.pep
MFRVHCNKCFRHRKTDPAVPFHLTQCRHVICGPCLGQSSLEKNCPLCGQV
LKAIQINRDMPTSVANYFADPLRFQQIYRKISKFQADQRASDNLGFYRQL
QQLEQNKRQLEGFCKMEAQLNQKVVEEKKRIAELRTYIAYHENAQRMTRR
RHSAGERFHTPEFKEAWNTSISTSDKSPSDMPSDSSRRSADLDTQSTRRR
SFGSDTKGFRL*

LD30246.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23233-PA 228 GF23233-PA 5..146 1..142 385 46.5 Plus
Dana\GF22805-PA 207 GF22805-PA 1..207 1..194 355 39.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:23:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19224-PA 209 GG19224-PA 1..209 1..211 885 78.7 Plus
Dere\GG12083-PA 219 GG12083-PA 1..219 1..211 565 51.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19167-PA 207 GH19167-PA 1..141 1..142 341 45.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12200-PA 211 CG12200-PA 1..211 1..211 1122 100 Plus
CG31053-PA 219 CG31053-PA 1..219 1..211 555 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23272-PA 230 GI23272-PA 1..143 1..142 329 44.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:23:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23882-PA 232 GL23882-PA 1..142 1..142 493 62 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15968-PA 232 GA15968-PA 1..142 1..142 491 61.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16310-PA 218 GM16310-PA 1..218 1..211 568 49.3 Plus
Dsec\GM24394-PA 218 GM24394-PA 1..218 1..211 568 49.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24872-PA 211 GD24872-PA 1..211 1..211 1060 92.9 Plus
Dsim\GD18048-PA 219 GD18048-PA 1..219 1..211 575 48.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10772-PA 172 GJ10772-PA 1..83 60..142 202 50.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19085-PA 217 GK19085-PA 1..142 1..144 336 42.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:23:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15842-PA 209 GE15842-PA 1..209 1..211 929 82 Plus
Dyak\GE10529-PA 218 GE10529-PA 1..218 1..211 581 51.6 Plus