Clone LD30488 Report

Search the DGRC for LD30488

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:304
Well:88
Vector:pOT2
Associated Gene/TranscriptCG9231-RA
Protein status:LD30488.pep: gold
Preliminary Size:957
Sequenced Size:832

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9231 2001-01-01 Release 2 assignment
CG9231 2002-03-19 Blastp of sequenced clone
CG9231 2003-01-01 Sim4 clustering to Release 3
CG9231 2008-04-29 Release 5.5 accounting
CG9231 2008-08-15 Release 5.9 accounting
CG9231 2008-12-18 5.12 accounting

Clone Sequence Records

LD30488.complete Sequence

832 bp (832 high quality bases) assembled on 2002-03-19

GenBank Submission: AY094812

> LD30488.complete
TAAAATTCCAATTCTCTTTTGCAAGATTACTTGTGAAACGATTAAAAAAG
GCAATATGCTAAGCAAAACGGGGTTAATTGGCGCCTTGGTGCGTAGATCC
TTCGGCACCAGTCAGATGTTGCGAGAGACGATCAAGAACCACGAGCCAAA
CAATCTGGAGCGCCGTATGTTGGTTTGGACCGGCAAATACAAGTCGCAGT
CCGAGATTCCCAATTTCGTTAGTCAGGATGTCATGGAGCGCTGCCGCAAC
AAAATGCGCATCCGCCTGGCCAACATAATGATCGCACTCACCGCCGTGGG
ATGCGCCATTATGGTGTACAGTGGCAAGCAGGCCGCCAAGAAAGGAGAAT
CCGTCACAAAGATGAATCTCGAGTGGCACAAACAGTTTAATGACTCTCAG
CAGAGCGAAGGATCTGCTCCGGCCGCCAAATAGAAAATCACTCCGAAATC
CCTCACTCGCCTAGTAATATTAGAACTGGCCAGGCTTCCATTTTCACTTC
CAAAGAAGATTGGCTAAAACTGGCCTTAAAAGATTTTGCTAATAATCAGT
TGGTCTGAAGATTGTTGAAAATTTTTCTTTTTAAATTTAGATTTTTATTT
TTGATTTGAATGTGTGCGTTCAACTAAAAAAATTCATAATTATCCCAATT
GGCCCATAAACTATGGAATGGAAAATGTTTGCAGGGCCAAATCTTTAGTG
AATTTTTTGGCTTGGAAAGCACTTTGCCATAAGCATGTGTACAAGCCGTG
TCCTTGATAGATATTCAGTGATATTTGTAATGTTGTATTATCAAAAATAA
AACATATTTATTGCAAAAAAAAAAAAAAAAAA

LD30488.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG9231-RA 1177 CG9231-RA 259..1075 1..817 4085 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:58:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19574472..19575065 814..221 2955 99.8 Minus
chr3L 24539361 chr3L 19575128..19575349 222..1 1110 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:24:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19585090..19585686 817..221 2985 100 Minus
3L 28110227 3L 19585749..19585970 222..1 1110 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19578190..19578786 817..221 2985 100 Minus
3L 28103327 3L 19578849..19579070 222..1 1110 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:58:56 has no hits.

LD30488.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:59:34 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19574472..19575063 223..814 93 <- Minus
chr3L 19575128..19575349 1..222 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:11:21 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 1..378 56..433 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:42:55 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 1..378 56..433 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:24:37 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 1..378 56..433 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:21:54 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 1..378 56..433 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:22:57 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 1..378 56..433 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:13 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 259..1072 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:42:55 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 259..1072 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:24:37 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 1..814 1..814 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:21:54 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 259..1072 1..814 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:22:57 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
CG9231-RA 1..814 1..814 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:34 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19585093..19585684 223..814 100 <- Minus
3L 19585749..19585970 1..222 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:34 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19585093..19585684 223..814 100 <- Minus
3L 19585749..19585970 1..222 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:59:34 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19585093..19585684 223..814 100 <- Minus
3L 19585749..19585970 1..222 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:24:37 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19578193..19578784 223..814 100 <- Minus
arm_3L 19578849..19579070 1..222 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:33 Download gff for LD30488.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19578193..19578784 223..814 100 <- Minus
3L 19578849..19579070 1..222 100   Minus

LD30488.hyp Sequence

Translation from 0 to 432

> LD30488.hyp
KIPILFCKITCETIKKGNMLSKTGLIGALVRRSFGTSQMLRETIKNHEPN
NLERRMLVWTGKYKSQSEIPNFVSQDVMERCRNKMRIRLANIMIALTAVG
CAIMVYSGKQAAKKGESVTKMNLEWHKQFNDSQQSEGSAPAAK*

LD30488.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9231-PB 125 CG9231-PB 1..125 19..143 638 100 Plus
CG9231-PA 125 CG9231-PA 1..125 19..143 638 100 Plus

LD30488.pep Sequence

Translation from 55 to 432

> LD30488.pep
MLSKTGLIGALVRRSFGTSQMLRETIKNHEPNNLERRMLVWTGKYKSQSE
IPNFVSQDVMERCRNKMRIRLANIMIALTAVGCAIMVYSGKQAAKKGESV
TKMNLEWHKQFNDSQQSEGSAPAAK*

LD30488.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:26:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10726-PA 125 GF10726-PA 1..125 1..125 542 74.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13394-PA 125 GG13394-PA 1..125 1..125 624 91.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:26:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14391-PA 125 GH14391-PA 1..122 1..114 450 68.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9231-PB 125 CG9231-PB 1..125 1..125 638 100 Plus
CG9231-PA 125 CG9231-PA 1..125 1..125 638 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13515-PA 130 GI13515-PA 1..129 1..123 445 63.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:26:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20886-PA 127 GL20886-PA 1..124 1..124 500 71.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21628-PA 127 GA21628-PA 1..124 1..124 494 71 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:26:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17624-PA 125 GM17624-PA 1..125 1..125 643 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12270-PA 125 GD12270-PA 1..125 1..125 647 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:26:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11876-PA 133 GJ11876-PA 1..133 1..125 444 59.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19422-PA 124 GK19422-PA 1..115 1..114 463 73 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:26:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22772-PA 125 GE22772-PA 1..125 1..125 620 89.6 Plus
Dyak\GE22486-PA 125 GE22486-PA 1..125 1..125 620 89.6 Plus