Clone LD30543 Report

Search the DGRC for LD30543

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:305
Well:43
Vector:pOT2
Associated Gene/TranscriptCG7133-RA
Protein status:LD30543.pep: gold
Preliminary Size:1590
Sequenced Size:1416

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7133 2001-01-01 Release 2 assignment
CG7133 2001-07-04 Blastp of sequenced clone
CG7133 2003-01-01 Sim4 clustering to Release 3
CG7133 2008-04-29 Release 5.5 accounting
CG7133 2008-08-15 Release 5.9 accounting
CG7133 2008-12-18 5.12 accounting

Clone Sequence Records

LD30543.complete Sequence

1416 bp (1416 high quality bases) assembled on 2001-07-04

GenBank Submission: AY051788

> LD30543.complete
CAGTGCCTTACATCCCGCAACATAAACATCAATAAATACCGACTTCTGCA
CCAAAAACCACTGACCATCGTGCTACTATCGATAAAATCATCTAATTATT
CTCCCATCAAATAGACCAATTGGCCAAAATGAGCGATGTCTACGAAGATC
ACTACCAGGTTCTGGGCTTACCGAGAAATGCCACCGACAGTGAGATTAAG
GATGCTTTTCGGCGGCTGTCCCTGCAATATCATCCCGACAAAAACGAGGA
TGGAGCGAAGGAGTTCCTTAGAATCAACGAGGCCCATCGCGTCCTGATTG
ACCATCAGAGAAGGGCCTTGTACGATTGCTGCTTCCAGTCCATGGACGTT
GAAGCCATTATTCCCGCTGAGAACGCTAATGGCCAACTGCCTGAATTGGG
AAATCCATTCTTCCCAATGCCACCCGAAACGCCGCCTGCTAGTTTTCGCG
AAAAGCTCAAAGTTGCTGCCTTCATCGGAGGCTTGCTGGTTGGTACATAC
GTGGGGTACCGGGTATTCCAGAAACCGCCGCCATCTATCCCAGTTCCCCG
GCCAATTCCAACGCAGGAACTAAGCGATTCGCATCTCGGATCCCTATGGA
CATTGTCCTCCGGGCTATTGGCATTGAGATCGAAAAGAATACTGGGACTC
GGCAAACTGGCGCCATGGGCAAATACTCGAGTTTCTCCTAGGACTCTGAA
CGCGCCCTTTTCTTCGGCTGCCAAAGTCGTGGCCAAAACAGTAATCCGAG
GCCAAAGAGCCGTAGGTTCTTCTGCAACTTCCAGTTCGTCCTTAGCATCG
GCTGCGAACGTGGCTGTGAAATCCCTACCAAGCAAAGCTTCAGTGAATTC
TGCTACGGAAACAGTCGCTAAAACACTTTCCCAGGGATCACGAGCTGGAC
CATATTCAGCTTTGAAAACAGTTTGGTCCTCAGCGGTTTCATATCTGCGC
TCTCTTCTAAATTGGGCAACTACACCGAAATGGGGGAAGGCAACACCAGC
AACCATTGCTGGTTTGGTTCATAACTCCAGACCAGTTTGGTCATCTGCAG
CAAAAAATACCCTTGCTGCCTTGATGTATGCATGCTCCAAAATATCTTCG
TATTTGCGCGCTTTGGCCGGGCGCTTTATTAGTCCCACCTTTAGACGCCT
CCAAAGACTACAATCTTTTAAAGGAAGCTTGAAAAATTGAAAAATTCCAT
ATCTGGTGACTCCGCTAAAAACGCGTAGAAGGCAACTCAGACAGAGCAGC
TCCGCCTCAATCTAAAGGTATATCCTGAAACATGTTTTGCTTTTTTAATC
AAGAAGCATTAAAGAAATAGGGTTAAAATAGAATCGAATACGATATGGCA
TACACACAAAAAAAAATTCAAATAAATAAAATTTTTATACCTTCGGAAAA
AAAAAAAAAAAAAAAA

LD30543.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:31:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG7133-RA 1455 CG7133-RA 59..1455 1..1396 6945 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22062003..22063399 1396..1 6935 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:24:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22073067..22074464 1397..1 6940 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:53:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22066167..22067564 1397..1 6950 99.9 Minus
Blast to na_te.dros performed 2019-03-16 05:15:07
Subject Length Description Subject Range Query Range Score Percent Strand
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 866..952 1297..1381 123 63.2 Plus
Tabor 7345 Tabor TABOR 7345bp 6753..6790 1350..1387 118 78.9 Plus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 959..1056 1290..1380 114 61.2 Plus

LD30543.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:15:46 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22062043..22063399 1..1356 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:11:27 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 1..1062 129..1190 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:19:45 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 1..1062 129..1190 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:08:58 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 1..1062 129..1190 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:51:21 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 1..1062 129..1190 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:01:08 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 1..1062 129..1190 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:15:50 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 59..1455 1..1396 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:19:44 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 59..1455 1..1396 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:08:58 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 60..1456 1..1396 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:51:22 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 59..1455 1..1396 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:08 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
CG7133-RA 60..1456 1..1396 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:46 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22073068..22074464 1..1396 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:46 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22073068..22074464 1..1396 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:15:46 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22073068..22074464 1..1396 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:08:58 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22066168..22067564 1..1396 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:29:47 Download gff for LD30543.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22066168..22067564 1..1396 99   Minus

LD30543.pep Sequence

Translation from 128 to 1189

> LD30543.pep
MSDVYEDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRIN
EAHRVLIDHQRRALYDCCFQSMDVEAIIPAENANGQLPELGNPFFPMPPE
TPPASFREKLKVAAFIGGLLVGTYVGYRVFQKPPPSIPVPRPIPTQELSD
SHLGSLWTLSSGLLALRSKRILGLGKLAPWANTRVSPRTLNAPFSSAAKV
VAKTVIRGQRAVGSSATSSSSLASAANVAVKSLPSKASVNSATETVAKTL
SQGSRAGPYSALKTVWSSAVSYLRSLLNWATTPKWGKATPATIAGLVHNS
RPVWSSAAKNTLAALMYACSKISSYLRALAGRFISPTFRRLQRLQSFKGS
LKN*

LD30543.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 15:15:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23491-PA 565 GF23491-PA 1..176 1..179 247 35 Plus
Dana\GF15175-PA 346 GF15175-PA 3..65 6..66 172 49.2 Plus
Dana\GF10972-PA 250 GF10972-PA 19..79 9..66 170 47.5 Plus
Dana\GF12761-PA 351 GF12761-PA 3..67 7..67 170 49.2 Plus
Dana\GF23490-PA 130 GF23490-PA 4..65 7..66 155 41.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 15:15:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13188-PA 329 GG13188-PA 1..304 1..333 748 55.5 Plus
Dere\GG24779-PA 350 GG24779-PA 3..65 6..66 171 49.2 Plus
Dere\GG16248-PA 249 GG16248-PA 19..79 9..66 168 47.5 Plus
Dere\GG17762-PA 131 GG17762-PA 3..122 6..131 166 35.9 Plus
Dere\GG22292-PA 353 GG22292-PA 3..67 7..67 164 47.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 15:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22993-PA 360 GH22993-PA 3..67 7..67 169 47.7 Plus
Dgri\GH16687-PA 262 GH16687-PA 19..79 9..66 167 47.5 Plus
Dgri\GH11404-PA 346 GH11404-PA 3..65 6..66 160 44.4 Plus
Dgri\GH15011-PA 353 GH15011-PA 3..65 6..66 158 44.4 Plus
Dgri\GH16902-PA 127 GH16902-PA 4..65 7..66 147 41.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG7133-PA 353 CG7133-PA 1..353 1..353 1803 100 Plus
CG32641-PA 132 CG32641-PA 3..123 6..131 174 34.1 Plus
CG32640-PA 132 CG32640-PA 3..123 6..131 174 34.1 Plus
CG5001-PC 346 CG5001-PC 3..65 6..66 169 49.2 Plus
CG5001-PD 350 CG5001-PD 3..65 6..66 169 49.2 Plus
CG5001-PA 350 CG5001-PA 3..65 6..66 169 49.2 Plus
CG5001-PB 350 CG5001-PB 3..65 6..66 169 49.2 Plus
mrj-PA 259 CG8448-PA 3..66 7..66 163 46.9 Plus
mrj-PC 259 CG8448-PC 3..66 7..66 163 46.9 Plus
mrj-PB 259 CG8448-PB 3..66 7..66 163 46.9 Plus
mrj-PD 259 CG8448-PD 3..66 7..66 163 46.9 Plus
Csp-PA 223 CG6395-PA 19..79 9..66 161 47.5 Plus
Csp-PC 228 CG6395-PC 19..79 9..66 161 47.5 Plus
Csp-PE 244 CG6395-PE 19..79 9..66 161 47.5 Plus
Csp-PD 244 CG6395-PD 19..79 9..66 161 47.5 Plus
Csp-PF 249 CG6395-PF 19..79 9..66 161 47.5 Plus
Csp-PB 249 CG6395-PB 19..79 9..66 161 47.5 Plus
mrj-PG 346 CG8448-PG 3..66 7..66 161 46.9 Plus
mrj-PH 346 CG8448-PH 3..66 7..66 161 46.9 Plus
mrj-PE 346 CG8448-PE 3..66 7..66 161 46.9 Plus
DnaJ-1-PA 334 CG10578-PA 3..65 6..66 156 49.2 Plus
DnaJ-1-PB 334 CG10578-PB 3..65 6..66 156 49.2 Plus
Droj2-PE 403 CG8863-PE 7..65 8..66 154 45.8 Plus
Droj2-PD 403 CG8863-PD 7..65 8..66 154 45.8 Plus
Droj2-PC 403 CG8863-PC 7..65 8..66 154 45.8 Plus
Droj2-PB 403 CG8863-PB 7..65 8..66 154 45.8 Plus
Droj2-PA 403 CG8863-PA 7..65 8..66 154 45.8 Plus
CG7130-PA 128 CG7130-PA 3..111 6..131 150 28.1 Plus
CG11035-PB 231 CG11035-PB 28..89 8..66 149 46.8 Plus
CG11035-PA 231 CG11035-PA 28..89 8..66 149 46.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 15:15:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11521-PA 505 GI11521-PA 3..65 6..66 169 49.2 Plus
Dmoj\GI11373-PA 249 GI11373-PA 18..78 9..66 167 47.5 Plus
Dmoj\GI18961-PA 355 GI18961-PA 3..67 7..67 165 47.7 Plus
Dmoj\GI15199-PA 325 GI15199-PA 3..65 6..66 164 49.2 Plus
Dmoj\GI13174-PA 352 GI13174-PA 3..65 6..66 163 46 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 15:15:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15626-PA 318 GL15626-PA 3..65 6..66 171 49.2 Plus
Dper\GL20793-PA 158 GL20793-PA 19..79 9..66 163 45.9 Plus
Dper\GL20776-PA 230 GL20776-PA 3..117 6..118 163 35.9 Plus
Dper\GL10681-PA 357 GL10681-PA 3..67 7..67 162 47.7 Plus
Dper\GL25452-PA 129 GL25452-PA 4..65 7..66 157 45.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 15:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18584-PA 346 GA18584-PA 3..65 6..66 172 49.2 Plus
Dpse\GA19562-PA 250 GA19562-PA 19..79 9..66 165 45.9 Plus
Dpse\GA21086-PA 357 GA21086-PA 3..67 7..67 162 47.7 Plus
Dpse\GA10408-PA 353 GA10408-PA 3..65 6..66 157 44.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 15:15:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22100-PA 339 GM22100-PA 1..335 1..333 1239 82.2 Plus
Dsec\GM16806-PA 350 GM16806-PA 3..65 6..66 174 49.2 Plus
Dsec\GM22437-PA 249 GM22437-PA 19..79 9..66 168 47.5 Plus
Dsec\DnaJ-1-PA 337 GM13903-PA 3..65 6..66 161 46 Plus
Dsec\GM20081-PA 344 GM20081-PA 3..67 7..67 160 47.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 15:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12076-PA 358 GD12076-PA 1..354 1..333 1190 76.8 Plus
Dsim\GD23083-PA 346 GD23083-PA 3..65 6..66 174 49.2 Plus
Dsim\GD17653-PA 189 GD17653-PA 20..80 9..66 165 47.5 Plus
Dsim\DnaJ-1-PA 352 GD13179-PA 3..65 6..66 161 46 Plus
Dsim\GD25559-PA 346 GD25559-PA 3..67 7..67 160 47.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 15:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11627-PA 245 GJ11627-PA 19..79 9..66 168 47.5 Plus
Dvir\GJ16971-PA 347 GJ16971-PA 3..65 6..66 164 47.6 Plus
Dvir\GJ14805-PA 325 GJ14805-PA 3..65 6..66 162 49.2 Plus
Dvir\GJ11949-PA 351 GJ11949-PA 3..65 6..66 162 46 Plus
Dvir\GJ21568-PA 352 GJ21568-PA 3..67 7..67 160 46.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 15:15:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15183-PA 346 GK15183-PA 3..65 6..66 172 49.2 Plus
Dwil\GK17108-PA 253 GK17108-PA 19..79 9..66 168 47.5 Plus
Dwil\GK19767-PA 330 GK19767-PA 3..82 6..84 166 40.7 Plus
Dwil\GK16875-PA 356 GK16875-PA 3..65 6..66 163 46 Plus
Dwil\GK19161-PA 125 GK19161-PA 4..65 7..66 157 46.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 15:15:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22994-PA 294 GE22994-PA 1..250 1..265 696 59.6 Plus
Dyak\GE17451-PA 350 GE17451-PA 3..65 6..66 171 49.2 Plus
Dyak\GE22607-PA 249 GE22607-PA 19..79 9..66 169 47.5 Plus
Dyak\GE14089-PA 351 GE14089-PA 3..67 7..67 166 47.7 Plus
Dyak\DnaJ-1-PA 351 GE20542-PA 3..65 6..66 161 46 Plus

LD30543.hyp Sequence

Translation from 128 to 1189

> LD30543.hyp
MSDVYEDHYQVLGLPRNATDSEIKDAFRRLSLQYHPDKNEDGAKEFLRIN
EAHRVLIDHQRRALYDCCFQSMDVEAIIPAENANGQLPELGNPFFPMPPE
TPPASFREKLKVAAFIGGLLVGTYVGYRVFQKPPPSIPVPRPIPTQELSD
SHLGSLWTLSSGLLALRSKRILGLGKLAPWANTRVSPRTLNAPFSSAAKV
VAKTVIRGQRAVGSSATSSSSLASAANVAVKSLPSKASVNSATETVAKTL
SQGSRAGPYSALKTVWSSAVSYLRSLLNWATTPKWGKATPATIAGLVHNS
RPVWSSAAKNTLAALMYACSKISSYLRALAGRFISPTFRRLQRLQSFKGS
LKN*

LD30543.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG7133-PA 353 CG7133-PA 1..353 1..353 1803 100 Plus
CG32641-PA 132 CG32641-PA 3..123 6..131 174 34.1 Plus
CG32640-PA 132 CG32640-PA 3..123 6..131 174 34.1 Plus
CG5001-PC 346 CG5001-PC 3..65 6..66 169 49.2 Plus
CG5001-PD 350 CG5001-PD 3..65 6..66 169 49.2 Plus