Clone LD30683 Report

Search the DGRC for LD30683

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:306
Well:83
Vector:pOT2
Associated Gene/TranscriptCG4968-RA
Protein status:LD30683.pep: gold
Preliminary Size:1185
Sequenced Size:1032

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4968 2001-01-01 Release 2 assignment
CG4968 2001-10-10 Blastp of sequenced clone
CG4968 2003-01-01 Sim4 clustering to Release 3
CG4968 2008-04-29 Release 5.5 accounting
CG4968 2008-08-15 Release 5.9 accounting
CG4968 2008-12-18 5.12 accounting

Clone Sequence Records

LD30683.complete Sequence

1032 bp (1032 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061382

> LD30683.complete
TCTAGACCTGTGTGTGTGACATTTGATGCGCCTACACATACATATGATGA
ACAGGAATTCTTTTTAGTTCATCAAATGAATACAAAGTAAAGTAAATTGA
AAGGAAGCGCCGATCGCAGTTGTTCAGTATTCAGAGAAACATGGAGCCGT
TTACCCATAATGATGGCAATCGCGACGAACTAATAATTCAGCAGAAACGG
GATATTGAAAAAGAGATCAGCGACACAACTCCCTTGGTCAGCGAGCAGTT
GCCACTCACCTGCTTGTATGCGGAATACAGTGGCGACGAGATCTTCACCG
CCAAGATCCAGGATCTGTCCAAAAAGTACAAGTTCATTCGCCGCACCCGC
CCCGATGGCAATTGTTTCTTCCGAGCCTTCGCCTACTCCTACTTGGAGTA
CTTGATCTCAAACACCAGTGCCTACCAGGAGTTCAAAAAACTGGCCGAGG
AGTCCAAGGAGAAGCTCGTTCAGCTGGGATTTCCTAGTTTTACATTGGAG
GACTTTCACGAAACGTTCATGGAAGTCATCCAGCGCGTTAGCCCCGACAA
TGCAGGAGGACACAGCACGGTCCAAGATGAGTTGCACAAGATCTTCAATG
AGCAGGGTTACTCAGACTACGTGGTGGTTTACCTACGTTTGATCACCTCG
GGAAAACTGCAGGAGGAGGCCGATTTTTACCAAAATTTCATCGAAGGCGA
CCTCACCATTGAGGCGTTCCGCCATCTGGAAGTGGAGCCGATGTACAAGG
AATCGGATCACATCCACATAATCGCTCTATGCACCGCCCTCGGCGCTGGA
GTTCGTGTCGAGTACTTGGACCGTGGCGAAGGTGGGACTGTGAAGGCCCA
CGATTTCCCCGAGGGAAGCGAGCCCCGAATTTACCTGATATATCGACCAG
GCCACTACGATATACTGTATCCAAATTGAATTGCTCTCAGTAGTTTCTAG
ATTACGAAACGATTTATGTATATAAGATGTATAATAAACTACCATTTATT
TGCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

LD30683.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:14:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG4968-RA 1135 CG4968-RA 70..1073 1..1004 5020 100 Plus
CG4968.a 1176 CG4968.a 111..1114 1..1004 5020 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:16:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10306412..10306900 515..1003 2445 100 Plus
chr2L 23010047 chr2L 10306047..10306348 214..515 1510 100 Plus
chr2L 23010047 chr2L 10305760..10305974 1..215 1075 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:24:17 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:16:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10307557..10308046 515..1004 2450 100 Plus
2L 23513712 2L 10307192..10307493 214..515 1510 100 Plus
2L 23513712 2L 10306905..10307119 1..215 1075 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10307557..10308046 515..1004 2450 100 Plus
2L 23513712 2L 10307192..10307493 214..515 1510 100 Plus
2L 23513712 2L 10306905..10307119 1..215 1075 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:16:06 has no hits.

LD30683.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:17:06 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10305760..10305974 1..215 100 -> Plus
chr2L 10306049..10306348 216..515 100 -> Plus
chr2L 10306413..10306900 516..1003 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:11:37 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 1..789 141..929 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:55:18 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 1..789 141..929 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:09:10 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 1..789 141..929 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:24:22 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 1..789 141..929 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:01:28 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 1..789 141..929 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:40:59 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 3..1005 1..1003 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:55:18 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 3..1005 1..1003 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:09:10 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 1..986 18..1003 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-08-04 17:07:48 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 3..1005 1..1003 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:01:28 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
CG4968-RA 1..986 18..1003 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:17:06 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10306905..10307119 1..215 100 -> Plus
2L 10307194..10307493 216..515 100 -> Plus
2L 10307558..10308045 516..1003 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:17:06 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10306905..10307119 1..215 100 -> Plus
2L 10307194..10307493 216..515 100 -> Plus
2L 10307558..10308045 516..1003 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:17:06 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10306905..10307119 1..215 100 -> Plus
2L 10307194..10307493 216..515 100 -> Plus
2L 10307558..10308045 516..1003 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:09:10 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10306905..10307119 1..215 100 -> Plus
arm_2L 10307194..10307493 216..515 100 -> Plus
arm_2L 10307558..10308045 516..1003 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:01:33 Download gff for LD30683.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10306905..10307119 1..215 100 -> Plus
2L 10307194..10307493 216..515 100 -> Plus
2L 10307558..10308045 516..1003 100   Plus

LD30683.pep Sequence

Translation from 140 to 928

> LD30683.pep
MEPFTHNDGNRDELIIQQKRDIEKEISDTTPLVSEQLPLTCLYAEYSGDE
IFTAKIQDLSKKYKFIRRTRPDGNCFFRAFAYSYLEYLISNTSAYQEFKK
LAEESKEKLVQLGFPSFTLEDFHETFMEVIQRVSPDNAGGHSTVQDELHK
IFNEQGYSDYVVVYLRLITSGKLQEEADFYQNFIEGDLTIEAFRHLEVEP
MYKESDHIHIIALCTALGAGVRVEYLDRGEGGTVKAHDFPEGSEPRIYLI
YRPGHYDILYPN*

LD30683.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15763-PA 262 GF15763-PA 1..262 1..262 1295 92 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10104-PA 262 GG10104-PA 1..262 1..262 1362 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13358-PA 262 GH13358-PA 1..262 1..262 1173 82.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG4968-PA 262 CG4968-PA 1..262 1..262 1380 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18262-PA 262 GI18262-PA 1..262 1..262 1153 81.3 Plus
Dmoj\GI11692-PA 264 GI11692-PA 12..264 10..262 1098 77.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25388-PA 262 GL25388-PA 1..262 1..262 1225 85.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18560-PA 262 GA18560-PA 1..262 1..262 1227 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18126-PA 268 GM18126-PA 12..268 6..262 1360 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23674-PA 262 GD23674-PA 1..262 1..262 1386 99.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:57:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21950-PA 262 GJ21950-PA 1..262 1..262 1167 83.2 Plus
Dvir\GJ11369-PA 262 GJ11369-PA 1..261 1..261 1143 79.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23559-PA 263 GK23559-PA 1..262 1..261 1150 79.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18919-PA 262 GE18919-PA 1..262 1..262 1364 98.1 Plus

LD30683.hyp Sequence

Translation from 140 to 928

> LD30683.hyp
MEPFTHNDGNRDELIIQQKRDIEKEISDTTPLVSEQLPLTCLYAEYSGDE
IFTAKIQDLSKKYKFIRRTRPDGNCFFRAFAYSYLEYLISNTSAYQEFKK
LAEESKEKLVQLGFPSFTLEDFHETFMEVIQRVSPDNAGGHSTVQDELHK
IFNEQGYSDYVVVYLRLITSGKLQEEADFYQNFIEGDLTIEAFRHLEVEP
MYKESDHIHIIALCTALGAGVRVEYLDRGEGGTVKAHDFPEGSEPRIYLI
YRPGHYDILYPN*

LD30683.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:04:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG4968-PA 262 CG4968-PA 1..262 1..262 1380 100 Plus