BDGP Sequence Production Resources |
Search the DGRC for LD31024
Library: | LD |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Ling Hong |
Date Registered: | 1997-12-04 |
Comments: | Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-) |
Original Plate Number: | 310 |
Well: | 24 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11137-RA |
Protein status: | LD31024.pep: gold |
Preliminary Size: | 612 |
Sequenced Size: | 653 |
Gene | Date | Evidence |
---|---|---|
CG11137 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11137 | 2002-05-18 | Blastp of sequenced clone |
CG11137 | 2008-04-29 | Release 5.5 accounting |
CG11137 | 2008-08-15 | Release 5.9 accounting |
CG11137 | 2008-12-18 | 5.12 accounting |
653 bp (653 high quality bases) assembled on 2002-05-18
GenBank Submission: AY118945
> LD31024.complete CAACACTCAGCGACCAATTGTCAGAAAAAATCGTCATTTTGTTTTATAAA TTGGCAAAAGATTAAATAAAAGAAAGCACAGCATGTCCGCCAAGCAAAAC CCAAAAAAGTTAAAGTGGGCGCTGGACTTTAACGGGAGCAAAAATGCTGA TATTCCTTCGCCGCTGGGCTACAATCCATCTGCTTTGGTGAACCAGAGTG AAGTGGTGCGCGACCAGCGCCTGGTCATCAAGAAGTCGTGGGACCTTGCC CTGGGACCTCTTAAGAACATTCCCATGAATCTATTCATCATGTACATGTC AGGAAACTCGATTTCCATTTTTCCCATCATGATGGTCGGCATGATGCTGA TCCGGCCTATCAAGGCCATCTTCACCACCCAGGTGACTTCCAAAATGGCG GAGGGGGCCCAGGGAACTGGCCAGCGCATCGTCTACTTCCTGGGCAACCT AGCAAACGTGGCTTTGGCCCTCTACAAGTGCCAGAGCATGGGGCTCCTCC CCACCCACGCCTCCGATTGGTTGGCATTTGTCCAGCCTCAGACACGCCTG GAATATTACGGCGGAGGAATTTCGTTTGTCTAGTTTTACACATATAGATT CTCTTTATTTGATCATAGATAAATTGGTTTAAACTAAAAAAAAAAAAAAA AAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 22856404..22856770 | 635..269 | 1835 | 100 | Minus |
chr3L | 24539361 | chr3L | 22857013..22857150 | 138..1 | 690 | 100 | Minus |
chr3L | 24539361 | chr3L | 22856823..22856954 | 268..137 | 660 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 22867484..22867854 | 639..269 | 1855 | 100 | Minus |
3L | 28110227 | 3L | 22868097..22868234 | 138..1 | 690 | 100 | Minus |
3L | 28110227 | 3L | 22867907..22868038 | 268..137 | 660 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 22860584..22860954 | 639..269 | 1855 | 100 | Minus |
3L | 28103327 | 3L | 22861197..22861334 | 138..1 | 690 | 100 | Minus |
3L | 28103327 | 3L | 22861007..22861138 | 268..137 | 660 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 22856404..22856770 | 269..635 | 100 | <- | Minus |
chr3L | 22856823..22856952 | 139..268 | 100 | <- | Minus |
chr3L | 22857013..22857150 | 1..138 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 1..501 | 83..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 1..501 | 83..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 1..501 | 83..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 1..501 | 83..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 1..501 | 83..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 1..635 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 16..650 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 10..644 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 1..635 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11137-RA | 10..644 | 1..635 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22867488..22867854 | 269..635 | 100 | <- | Minus |
3L | 22867907..22868036 | 139..268 | 100 | <- | Minus |
3L | 22868097..22868234 | 1..138 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22867488..22867854 | 269..635 | 100 | <- | Minus |
3L | 22867907..22868036 | 139..268 | 100 | <- | Minus |
3L | 22868097..22868234 | 1..138 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22867488..22867854 | 269..635 | 100 | <- | Minus |
3L | 22867907..22868036 | 139..268 | 100 | <- | Minus |
3L | 22868097..22868234 | 1..138 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 22860588..22860954 | 269..635 | 100 | <- | Minus |
arm_3L | 22861007..22861136 | 139..268 | 100 | <- | Minus |
arm_3L | 22861197..22861334 | 1..138 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 22861197..22861334 | 1..138 | 100 | Minus | |
3L | 22860588..22860954 | 269..635 | 100 | <- | Minus |
3L | 22861007..22861136 | 139..268 | 100 | <- | Minus |
Translation from 82 to 582
> LD31024.hyp MSAKQNPKKLKWALDFNGSKNADIPSPLGYNPSALVNQSEVVRDQRLVIK KSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQ VTSKMAEGAQGTGQRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAFV QPQTRLEYYGGGISFV*
Translation from 82 to 582
> LD31024.pep MSAKQNPKKLKWALDFNGSKNADIPSPLGYNPSALVNQSEVVRDQRLVIK KSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQ VTSKMAEGAQGTGQRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAFV QPQTRLEYYGGGISFV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23442-PA | 167 | GF23442-PA | 1..167 | 1..166 | 789 | 88 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13165-PA | 166 | GG13165-PA | 1..166 | 1..166 | 855 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14764-PA | 166 | GH14764-PA | 1..166 | 1..166 | 803 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11137-PB | 166 | CG11137-PB | 1..166 | 1..166 | 856 | 100 | Plus |
CG11137-PA | 166 | CG11137-PA | 1..166 | 1..166 | 856 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11865-PA | 166 | GI11865-PA | 1..166 | 1..166 | 814 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25180-PA | 166 | GL25180-PA | 1..166 | 1..166 | 844 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10785-PA | 166 | GA10785-PA | 1..166 | 1..166 | 844 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22074-PA | 166 | GM22074-PA | 1..166 | 1..166 | 851 | 97 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12050-PA | 166 | GD12050-PA | 1..166 | 1..166 | 844 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13560-PA | 166 | GJ13560-PA | 1..166 | 1..166 | 814 | 91.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK20497-PA | 168 | GK20497-PA | 1..168 | 1..166 | 802 | 89.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19487-PA | 166 | GE19487-PA | 1..166 | 1..166 | 851 | 97 | Plus |