Clone LD31024 Report

Search the DGRC for LD31024

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:310
Well:24
Vector:pOT2
Associated Gene/TranscriptCG11137-RA
Protein status:LD31024.pep: gold
Preliminary Size:612
Sequenced Size:653

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11137 2002-01-01 Sim4 clustering to Release 2
CG11137 2002-05-18 Blastp of sequenced clone
CG11137 2008-04-29 Release 5.5 accounting
CG11137 2008-08-15 Release 5.9 accounting
CG11137 2008-12-18 5.12 accounting

Clone Sequence Records

LD31024.complete Sequence

653 bp (653 high quality bases) assembled on 2002-05-18

GenBank Submission: AY118945

> LD31024.complete
CAACACTCAGCGACCAATTGTCAGAAAAAATCGTCATTTTGTTTTATAAA
TTGGCAAAAGATTAAATAAAAGAAAGCACAGCATGTCCGCCAAGCAAAAC
CCAAAAAAGTTAAAGTGGGCGCTGGACTTTAACGGGAGCAAAAATGCTGA
TATTCCTTCGCCGCTGGGCTACAATCCATCTGCTTTGGTGAACCAGAGTG
AAGTGGTGCGCGACCAGCGCCTGGTCATCAAGAAGTCGTGGGACCTTGCC
CTGGGACCTCTTAAGAACATTCCCATGAATCTATTCATCATGTACATGTC
AGGAAACTCGATTTCCATTTTTCCCATCATGATGGTCGGCATGATGCTGA
TCCGGCCTATCAAGGCCATCTTCACCACCCAGGTGACTTCCAAAATGGCG
GAGGGGGCCCAGGGAACTGGCCAGCGCATCGTCTACTTCCTGGGCAACCT
AGCAAACGTGGCTTTGGCCCTCTACAAGTGCCAGAGCATGGGGCTCCTCC
CCACCCACGCCTCCGATTGGTTGGCATTTGTCCAGCCTCAGACACGCCTG
GAATATTACGGCGGAGGAATTTCGTTTGTCTAGTTTTACACATATAGATT
CTCTTTATTTGATCATAGATAAATTGGTTTAAACTAAAAAAAAAAAAAAA
AAA

LD31024.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:03:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG11137-RA 840 CG11137-RA 132..770 1..639 3195 100 Plus
CG33170-RB 704 CG33170-RB 651..704 639..586 270 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:29:49
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 22856404..22856770 635..269 1835 100 Minus
chr3L 24539361 chr3L 22857013..22857150 138..1 690 100 Minus
chr3L 24539361 chr3L 22856823..22856954 268..137 660 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:24:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:29:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 22867484..22867854 639..269 1855 100 Minus
3L 28110227 3L 22868097..22868234 138..1 690 100 Minus
3L 28110227 3L 22867907..22868038 268..137 660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:34:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 22860584..22860954 639..269 1855 100 Minus
3L 28103327 3L 22861197..22861334 138..1 690 100 Minus
3L 28103327 3L 22861007..22861138 268..137 660 100 Minus
Blast to na_te.dros performed on 2019-03-16 20:29:48 has no hits.

LD31024.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:30:59 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 22856404..22856770 269..635 100 <- Minus
chr3L 22856823..22856952 139..268 100 <- Minus
chr3L 22857013..22857150 1..138 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:12:10 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 1..501 83..583 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:44:38 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 1..501 83..583 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:23:23 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 1..501 83..583 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:36:50 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 1..501 83..583 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:04:36 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 1..501 83..583 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:19:41 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:44:38 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 16..650 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:23:23 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 10..644 1..635 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:36:50 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 1..635 1..635 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:04:36 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
CG11137-RA 10..644 1..635 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:30:59 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22867488..22867854 269..635 100 <- Minus
3L 22867907..22868036 139..268 100 <- Minus
3L 22868097..22868234 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:30:59 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22867488..22867854 269..635 100 <- Minus
3L 22867907..22868036 139..268 100 <- Minus
3L 22868097..22868234 1..138 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:30:59 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22867488..22867854 269..635 100 <- Minus
3L 22867907..22868036 139..268 100 <- Minus
3L 22868097..22868234 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:23:23 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 22860588..22860954 269..635 100 <- Minus
arm_3L 22861007..22861136 139..268 100 <- Minus
arm_3L 22861197..22861334 1..138 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:09:13 Download gff for LD31024.complete
Subject Subject Range Query Range Percent Splice Strand
3L 22861197..22861334 1..138 100   Minus
3L 22860588..22860954 269..635 100 <- Minus
3L 22861007..22861136 139..268 100 <- Minus

LD31024.hyp Sequence

Translation from 82 to 582

> LD31024.hyp
MSAKQNPKKLKWALDFNGSKNADIPSPLGYNPSALVNQSEVVRDQRLVIK
KSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQ
VTSKMAEGAQGTGQRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAFV
QPQTRLEYYGGGISFV*

LD31024.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG11137-PB 166 CG11137-PB 1..166 1..166 856 100 Plus
CG11137-PA 166 CG11137-PA 1..166 1..166 856 100 Plus

LD31024.pep Sequence

Translation from 82 to 582

> LD31024.pep
MSAKQNPKKLKWALDFNGSKNADIPSPLGYNPSALVNQSEVVRDQRLVIK
KSWDLALGPLKNIPMNLFIMYMSGNSISIFPIMMVGMMLIRPIKAIFTTQ
VTSKMAEGAQGTGQRIVYFLGNLANVALALYKCQSMGLLPTHASDWLAFV
QPQTRLEYYGGGISFV*

LD31024.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:30:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23442-PA 167 GF23442-PA 1..167 1..166 789 88 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13165-PA 166 GG13165-PA 1..166 1..166 855 97 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:30:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14764-PA 166 GH14764-PA 1..166 1..166 803 89.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:24:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG11137-PB 166 CG11137-PB 1..166 1..166 856 100 Plus
CG11137-PA 166 CG11137-PA 1..166 1..166 856 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11865-PA 166 GI11865-PA 1..166 1..166 814 91.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:30:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25180-PA 166 GL25180-PA 1..166 1..166 844 94.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10785-PA 166 GA10785-PA 1..166 1..166 844 94.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:30:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22074-PA 166 GM22074-PA 1..166 1..166 851 97 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12050-PA 166 GD12050-PA 1..166 1..166 844 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:30:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13560-PA 166 GJ13560-PA 1..166 1..166 814 91.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20497-PA 168 GK20497-PA 1..168 1..166 802 89.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:30:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19487-PA 166 GE19487-PA 1..166 1..166 851 97 Plus