Clone LD31204 Report

Search the DGRC for LD31204

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:312
Well:4
Vector:pOT2
Associated Gene/TranscriptCG7197-RA
Protein status:LD31204.pep: gold
Preliminary Size:1386
Sequenced Size:1291

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7197 2001-01-01 Release 2 assignment
CG7197 2002-04-04 Blastp of sequenced clone
CG7197 2003-01-01 Sim4 clustering to Release 3
CG7197 2008-04-29 Release 5.5 accounting
CG7197 2008-08-15 Release 5.9 accounting
CG7197 2008-12-18 5.12 accounting

Clone Sequence Records

LD31204.complete Sequence

1291 bp (1291 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095045

> LD31204.complete
TTCTTAATTAAAACTCTGTTAATTAAATTATCAACAACGGCTGTTCTAAA
CCCACTGCGACGCGTAAACGAAGTAGCGTTTCCCGCTGCAACGAAACGAA
TGGAAACCACCCAAAGGCAAACCACCTGAAAATCGCTCACCAATCCCCCC
AAAAAAATTCCCATTTGGCGAAAACAACAACAGTAATTAGGGTGTGAGAG
TGTGGAGTGAATAGCTGAATAGTTAAATCAGTGAATAATTTACCGTACGG
CCTTCGCCTTCCCCTGCGGAAACAACAACAAAGCTCAGCGTTCACTTACA
CCCACACACACGGGTCTACCACGCATACACACGCAGGCCAGCCGATAACC
TGTGTGTGAGGCAATCGCCGTCATCGTTCGAAATCAAATCTCTAATCGGT
GGAAGCAGCAACAACAATAACAGCAGCTGCAGCATAATCAACAATTGATT
ATATACGTATATAGCTAAAAATAAGGTTCAAATATGGGACTGTTATTATC
GCGGCTCTGGCGGATGTTTGGCAACGAGGAGCACAAGCTGGTGATGGTGG
GTCTGGACAACGCGGGCAAAACCACCATCCTGTACCAGTTCCTGATGAAC
GAAGTGGTCCACACAAGTCCCACGATCGGTTCCAACGTGGAGGAGGTCGT
CTGGCGGAATATACACTTTCTTGTCTGGGATCTTGGTGGTCAGCAGAGTC
TGCGCGCCGCTTGGAGCACCTACTACACGAACACAGAGCTGGTGATCATG
GTCATCGACTCCACGGACCGGGAACGGTTAGCTGTTACGCGGGAAGAGCT
CTACCGGATGCTGCAACATGAGGATCTGAGCAAGGCCAGTTTGCTGGTCT
ATGCCAATAAGCAGGATCTCAAGGGCTCTATGTCGGCGGCGGAAATCTCA
CGACAACTGGACCTCACCTCCATCAAGAAGCACCAATGGCACATCCAGGC
CTGCTGTGCGCTCACCGGCGAAGGACTCTATCAAGGATTAGAGTGGATCG
TGCAGCGCATCAAGAACAAATGACCCGCCACACATGCTACATATTAGCTA
ATTAATCATTAACGACTAGCTGTCTAGAGAAAGTAAACCAATTTTGATAT
AAACAATTTTTAAGCGTTTCCAAATTGTTTGAAAAGTTGTTGCCAAGCCA
ATTTTATTTAGTGTAAAATACGTCCGAACAGGAGTCCCTCGATGATTTAA
ATCTACGTGTATATGGATAATGTCTAGGAGCTAAGCCAATTTAACTACGA
TACTTCCAATAAAATTACAAAATAAAAAAAAAAAAAAAAAA

LD31204.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:17:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG7197-RA 1303 CG7197-RA 25..1300 1..1276 6380 100 Plus
Rab-RP3-RA 1181 Rab-RP3-RA 1076..1181 1276..1171 530 100 Minus
CG13671-RA 2656 CG13671-RA 1..83 83..1 415 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:27:10
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8290492..8291766 1273..1 6280 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:24:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:27:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8298498..8299773 1276..1 6380 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8291598..8292873 1276..1 6380 100 Minus
Blast to na_te.dros performed 2019-03-15 22:27:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2452..2500 395..443 137 75.5 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 6062..6098 402..438 131 83.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2330..2371 402..443 129 78.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1540..1579 404..443 128 80 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2809..2848 404..443 128 80 Plus
roo 9092 roo DM_ROO 9092bp 1138..1227 402..484 128 65.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2384..2426 402..444 125 76.7 Plus
roo 9092 roo DM_ROO 9092bp 1055..1107 390..440 125 73.6 Plus
roo 9092 roo DM_ROO 9092bp 1093..1135 402..444 125 76.7 Plus
roo 9092 roo DM_ROO 9092bp 1116..1156 404..444 124 78 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2411..2452 402..443 120 76.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6832..6873 402..443 120 76.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2626..2670 404..448 117 73.3 Plus
S-element 1736 S-element DM33463 1736bp Derived from U33463 (g1006788) (Rel. 47, Last updated, Version 5). 1438..1502 1142..1078 117 68.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6784..6826 402..444 116 74.4 Plus
Dyak\HeT-A 5691 Dyak\HeT-A YAKHETA 5691bp 56..121 1159..1094 114 63.6 Minus
TART-C 11124 TART-C TARTC 11124bp 7517..7553 402..438 113 78.4 Plus

LD31204.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:28:23 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8290492..8291766 1..1273 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:12:23 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 1..540 484..1023 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:17:00 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 1..540 484..1023 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:20:14 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 1..540 484..1023 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:57:40 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 1..540 484..1023 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:22:56 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 1..540 484..1023 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:47:02 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 25..1297 1..1273 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:17:00 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 25..1297 1..1273 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:20:14 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 67..1339 1..1273 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:57:41 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 25..1297 1..1273 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:22:56 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
CG7197-RA 67..1339 1..1273 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:23 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8298501..8299773 1..1273 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:23 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8298501..8299773 1..1273 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:28:23 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8298501..8299773 1..1273 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:20:14 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8291601..8292873 1..1273 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:30:13 Download gff for LD31204.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8291601..8292873 1..1273 100   Minus

LD31204.pep Sequence

Translation from 483 to 1022

> LD31204.pep
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK*

LD31204.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23565-PA 179 GF23565-PA 1..179 1..179 945 99.4 Plus
Dana\GF23441-PA 182 GF23441-PA 1..179 1..178 509 51.4 Plus
Dana\GF23416-PA 180 GF23416-PA 1..180 1..179 476 50 Plus
Dana\GF24106-PA 180 GF24106-PA 1..179 1..179 441 45.3 Plus
Dana\GF13030-PA 175 GF13030-PA 1..169 1..172 438 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15097-PA 179 GG15097-PA 1..179 1..179 948 100 Plus
Dere\GG13164-PA 182 GG13164-PA 1..179 1..178 509 51.4 Plus
Dere\GG16407-PA 180 GG16407-PA 1..180 1..179 469 48.3 Plus
Dere\GG20511-PA 175 GG20511-PA 1..169 1..172 440 45.9 Plus
Dere\GG15940-PA 190 GG15940-PA 12..189 2..179 437 44.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15973-PA 179 GH15973-PA 1..179 1..179 940 98.3 Plus
Dgri\GH14762-PA 182 GH14762-PA 1..179 1..178 509 51.4 Plus
Dgri\GH23951-PA 180 GH23951-PA 1..180 1..179 474 49.4 Plus
Dgri\GH14763-PA 182 GH14763-PA 1..179 1..178 464 46.9 Plus
Dgri\GH20425-PA 175 GH20425-PA 1..169 1..172 451 46.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:34:27
Subject Length Description Subject Range Query Range Score Percent Strand
Arl5-PA 179 CG7197-PA 1..179 1..179 931 100 Plus
Arf79F-PJ 182 CG8385-PJ 1..179 1..178 493 51.4 Plus
Arf79F-PI 182 CG8385-PI 1..179 1..178 493 51.4 Plus
Arf79F-PH 182 CG8385-PH 1..179 1..178 493 51.4 Plus
Arf79F-PF 182 CG8385-PF 1..179 1..178 493 51.4 Plus
Arf79F-PC 182 CG8385-PC 1..179 1..178 493 51.4 Plus
Arf79F-PE 182 CG8385-PE 1..179 1..178 493 51.4 Plus
Arf79F-PB 182 CG8385-PB 1..179 1..178 493 51.4 Plus
Arf79F-PA 182 CG8385-PA 1..179 1..178 493 51.4 Plus
Arf102F-PB 180 CG11027-PB 1..180 1..179 462 48.9 Plus
Arf102F-PA 180 CG11027-PA 1..180 1..179 462 48.9 Plus
Arl1-PA 180 CG6025-PA 1..179 1..179 431 45.3 Plus
Arf51F-PE 175 CG8156-PE 1..174 1..177 430 45.2 Plus
Arf51F-PA 175 CG8156-PA 1..174 1..177 430 45.2 Plus
Arf51F-PC 175 CG8156-PC 1..174 1..177 430 45.2 Plus
Arf51F-PB 175 CG8156-PB 1..174 1..177 430 45.2 Plus
Arf51F-PD 175 CG8156-PD 1..174 1..177 430 45.2 Plus
dnd-PA 179 CG6560-PA 1..178 1..177 383 41 Plus
Arl2-PA 184 CG7435-PA 16..179 16..179 338 40.9 Plus
Arl4-PA 312 CG2219-PA 27..160 19..147 270 41.8 Plus
Arl4-PB 313 CG2219-PB 28..161 19..147 270 41.8 Plus
Arl6-PA 202 CG7735-PA 20..184 19..177 260 33.9 Plus
Arl6-PB 201 CG7735-PB 20..183 19..177 259 34.1 Plus
Arfrp1-PA 200 CG7039-PA 12..188 11..177 258 36.3 Plus
CG17819-PA 186 CG17819-PA 17..183 13..178 243 31.2 Plus
Arl8-PC 186 CG7891-PC 15..184 11..179 237 27.6 Plus
Arl8-PB 186 CG7891-PB 15..184 11..179 237 27.6 Plus
Arl8-PA 186 CG7891-PA 15..184 11..179 237 27.6 Plus
Sar1-PE 193 CG7073-PE 16..192 8..176 227 29.8 Plus
Sar1-PC 193 CG7073-PC 16..192 8..176 227 29.8 Plus
Sar1-PD 193 CG7073-PD 16..192 8..176 227 29.8 Plus
Sar1-PA 193 CG7073-PA 16..192 8..176 227 29.8 Plus
Arl4-PC 100 CG2219-PC 27..93 19..80 173 49.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16622-PA 179 GI16622-PA 1..179 1..179 943 98.9 Plus
Dmoj\GI11864-PA 182 GI11864-PA 1..179 1..178 509 51.4 Plus
Dmoj\GI14031-PA 180 GI14031-PA 1..180 1..179 475 49.4 Plus
Dmoj\GI19608-PA 175 GI19608-PA 1..169 1..172 450 46.5 Plus
Dmoj\GI11881-PA 180 GI11881-PA 1..172 1..172 440 47.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22555-PA 179 GL22555-PA 1..179 1..179 948 100 Plus
Dper\GL25178-PA 182 GL25178-PA 1..179 1..178 509 51.4 Plus
Dper\GL18404-PA 180 GL18404-PA 1..180 1..179 474 49.4 Plus
Dper\GL17751-PA 175 GL17751-PA 1..169 1..172 449 47.1 Plus
Dper\GL24385-PA 181 GL24385-PA 1..178 1..178 449 47.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20174-PA 179 GA20174-PA 1..179 1..179 948 100 Plus
Dpse\GA21036-PA 182 GA21036-PA 1..179 1..178 509 51.4 Plus
Dpse\GA10714-PA 180 GA10714-PA 1..180 1..179 474 49.4 Plus
Dpse\GA20856-PA 175 GA20856-PA 1..169 1..172 449 47.1 Plus
Dpse\GA23613-PA 181 GA23613-PA 1..178 1..178 449 47.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:37:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24953-PA 179 GM24953-PA 1..179 1..179 948 100 Plus
Dsec\GM22073-PA 182 GM22073-PA 1..179 1..178 509 51.4 Plus
Dsec\GM13026-PA 180 GM13026-PA 1..180 1..179 471 48.9 Plus
Dsec\GM25571-PA 180 GM25571-PA 1..179 1..179 441 45.3 Plus
Dsec\GM21603-PA 175 GM21603-PA 1..169 1..172 440 45.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13004-PA 179 GD13004-PA 1..179 1..179 948 100 Plus
Dsim\GD12049-PA 182 GD12049-PA 1..179 1..178 509 51.4 Plus
Dsim\GD20493-PA 180 GD20493-PA 1..180 1..179 471 48.9 Plus
Dsim\GD14586-PA 180 GD14586-PA 1..179 1..179 441 45.3 Plus
Dsim\GD11108-PA 175 GD11108-PA 1..169 1..172 440 45.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12878-PA 179 GJ12878-PA 1..179 1..179 940 98.3 Plus
Dvir\GJ13559-PA 182 GJ13559-PA 1..179 1..178 509 51.4 Plus
Dvir\GJ19602-PA 180 GJ19602-PA 1..180 1..179 475 49.4 Plus
Dvir\GJ14973-PA 175 GJ14973-PA 1..169 1..172 450 46.5 Plus
Dvir\GJ13575-PA 180 GJ13575-PA 1..179 1..179 442 45.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17000-PA 179 GK17000-PA 1..179 1..179 944 99.4 Plus
Dwil\GK20496-PA 182 GK20496-PA 1..179 1..178 509 51.4 Plus
Dwil\GK13623-PA 180 GK13623-PA 1..180 1..179 476 50 Plus
Dwil\GK20891-PA 175 GK20891-PA 1..169 1..172 446 46.5 Plus
Dwil\GK24495-PA 167 GK24495-PA 1..166 14..179 422 45.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21319-PA 179 GE21319-PA 1..179 1..179 948 100 Plus
Dyak\GE19486-PA 182 GE19486-PA 1..179 1..178 509 51.4 Plus
Dyak\Arf102F-PA 180 GE14567-PA 1..180 1..179 470 48.3 Plus
Dyak\GE22880-PA 180 GE22880-PA 1..179 1..179 441 45.3 Plus
Dyak\GE13644-PA 175 GE13644-PA 1..169 1..172 440 45.9 Plus

LD31204.hyp Sequence

Translation from 483 to 1022

> LD31204.hyp
MGLLLSRLWRMFGNEEHKLVMVGLDNAGKTTILYQFLMNEVVHTSPTIGS
NVEEVVWRNIHFLVWDLGGQQSLRAAWSTYYTNTELVIMVIDSTDRERLA
VTREELYRMLQHEDLSKASLLVYANKQDLKGSMSAAEISRQLDLTSIKKH
QWHIQACCALTGEGLYQGLEWIVQRIKNK*

LD31204.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:36:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG7197-PA 179 CG7197-PA 1..179 1..179 931 100 Plus
Arf79F-PJ 182 CG8385-PJ 1..179 1..178 493 51.4 Plus
Arf79F-PI 182 CG8385-PI 1..179 1..178 493 51.4 Plus
Arf79F-PH 182 CG8385-PH 1..179 1..178 493 51.4 Plus
Arf79F-PF 182 CG8385-PF 1..179 1..178 493 51.4 Plus