Clone LD31229 Report

Search the DGRC for LD31229

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:312
Well:29
Vector:pOT2
Associated Gene/TranscriptCG8132-RA
Protein status:LD31229.pep: gold
Preliminary Size:1215
Sequenced Size:1069

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8132 2001-01-01 Release 2 assignment
CG8132 2002-04-09 Blastp of sequenced clone
CG8132 2003-01-01 Sim4 clustering to Release 3
CG8132 2008-04-29 Release 5.5 accounting
CG8132 2008-08-15 Release 5.9 accounting
CG8132 2008-12-18 5.12 accounting

Clone Sequence Records

LD31229.complete Sequence

1069 bp (1069 high quality bases) assembled on 2002-04-09

GenBank Submission: AY095190

> LD31229.complete
AAATCTGTTATCAAACCGCGAAAAGATAACATTTAATTGCAGCAATATGA
GCAAAACTAGCAACATCATGCGTTTGGCGCTGCTGCAGCTCAAGGGTTCC
AAGGACAAAGTGGCCAATGTCCAAAACGCCGTCACCAAAATCGAGGCGGC
GGTCAAGGAGCATAAACCCCGATTGATCACTCTGCCGGAGTGCTTTAATG
CTCCATACGGCACCAAGTACTTTCGGGAGTACTCCGAGACCATTCCCGAT
GGCTATACCTCGCAACAGCTCTCCAATTTGGCCAGGAAGCACCAGGTGTA
CATCGTGGGCGGAACAATCCCTGAACTGGGCGAAAACGATGCCATCTACA
ACACCTGCACGGTTTGGTCACCCACTGGTGACCTTGTGGCCAAGCATCGC
AAGATGCATCTCTTTGACATAGATGTCAAGGGTGGCATTCGCTTCAAGGA
GTCGGAAACGCTGTCCGCAGGCAATGATTTCACCATCATCAACGTAGATG
GCCACAAGATTGGCATCGGCATCTGCTACGATATTCGATTCGAGGAGATG
GCGAGGCTCTATCGCAACGCAGGCTGCGAGATGATCATCTATCCGGCTGC
ATTCAACATGACCACTGGTCCACTGCACTGGGAGCTATTGCAGCGATCCC
GTGCCAATGACAACCAACTCTTTGTGGTCACAACATCACCAGCCCGTGAC
ACAAGCGCCGAGTATGTAGCCTATGGCCATTCCATGGTGGTGAATCCATG
GGCCAAGGTGCAGCAGAGTGCCAGTGAAGGCGAGGAAATCGTGGTGGCCG
ATATAGATTTCTCCGAGGTGGAGCAGGTGCGTCAGCAGATTCCCGTCTTT
GGGCAAAGACGTCTAGATCTGTACGCCACCGAAAGGAAGGCCAAATAAAG
GATTGCTTTAAATGGGAAATGGGAAATCTTCAAAAATTCAAGAATCTGTC
GTTTTAAGCACCTTTAAAGCATTGCATTTATGTTATTTGATTGTATATAA
AATTTATTAGGCCTACACACACATATAACATTGATTTCTGTCGAAAAAAA
AAAAAAAAAAAAAAAAAAA

LD31229.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG8132-RA 1167 CG8132-RA 125..1167 1..1043 5215 100 Plus
CG9356-RB 1662 CG9356-RB 1565..1662 1048..951 490 100 Minus
CG9356-RA 1578 CG9356-RA 1519..1578 1048..989 300 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:10:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5227474..5228451 66..1043 4860 99.8 Plus
chr3R 27901430 chr3R 5227354..5227418 1..65 310 98.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:25:00 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:10:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9401641..9402623 66..1048 4915 100 Plus
3R 32079331 3R 9401521..9401585 1..65 325 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:46:03
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9142472..9143454 66..1048 4915 100 Plus
3R 31820162 3R 9142352..9142416 1..65 325 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:10:33 has no hits.

LD31229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:11:22 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5227354..5227418 1..65 98 -> Plus
chr3R 5227474..5228451 66..1043 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:12:31 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 1..852 47..898 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:09:58 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 1..852 47..898 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:02:46 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 1..852 47..898 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:56:08 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 1..852 47..898 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:25:31 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 1..852 47..898 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:44:50 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 2..1044 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:09:58 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 2..1044 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:02:46 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 27..1069 1..1043 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:56:08 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 2..1044 1..1043 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:25:31 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
CG8132-RA 27..1069 1..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:11:22 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9401521..9401585 1..65 100 -> Plus
3R 9401641..9402618 66..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:11:22 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9401521..9401585 1..65 100 -> Plus
3R 9401641..9402618 66..1043 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:11:22 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9401521..9401585 1..65 100 -> Plus
3R 9401641..9402618 66..1043 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:02:46 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5227243..5227307 1..65 100 -> Plus
arm_3R 5227363..5228340 66..1043 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:28:31 Download gff for LD31229.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9142472..9143449 66..1043 100   Plus
3R 9142352..9142416 1..65 100 -> Plus

LD31229.hyp Sequence

Translation from 0 to 897

> LD31229.hyp
NLLSNREKITFNCSNMSKTSNIMRLALLQLKGSKDKVANVQNAVTKIEAA
VKEHKPRLITLPECFNAPYGTKYFREYSETIPDGYTSQQLSNLARKHQVY
IVGGTIPELGENDAIYNTCTVWSPTGDLVAKHRKMHLFDIDVKGGIRFKE
SETLSAGNDFTIINVDGHKIGIGICYDIRFEEMARLYRNAGCEMIIYPAA
FNMTTGPLHWELLQRSRANDNQLFVVTTSPARDTSAEYVAYGHSMVVNPW
AKVQQSASEGEEIVVADIDFSEVEQVRQQIPVFGQRRLDLYATERKAK*

LD31229.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG8132-PA 283 CG8132-PA 1..283 16..298 1473 100 Plus
NitFhit-PA 460 CG7067-PA 35..301 25..292 383 34.6 Plus

LD31229.pep Sequence

Translation from 46 to 897

> LD31229.pep
MSKTSNIMRLALLQLKGSKDKVANVQNAVTKIEAAVKEHKPRLITLPECF
NAPYGTKYFREYSETIPDGYTSQQLSNLARKHQVYIVGGTIPELGENDAI
YNTCTVWSPTGDLVAKHRKMHLFDIDVKGGIRFKESETLSAGNDFTIINV
DGHKIGIGICYDIRFEEMARLYRNAGCEMIIYPAAFNMTTGPLHWELLQR
SRANDNQLFVVTTSPARDTSAEYVAYGHSMVVNPWAKVQQSASEGEEIVV
ADIDFSEVEQVRQQIPVFGQRRLDLYATERKAK*

LD31229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 02:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17210-PA 283 GF17210-PA 1..283 1..283 1424 90.5 Plus
Dana\GF18199-PA 279 GF18199-PA 1..278 8..281 833 55 Plus
Dana\GF23869-PA 448 GF23869-PA 22..290 10..277 389 33.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 02:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16743-PA 283 GG16743-PA 1..283 1..283 1464 94 Plus
Dere\GG16651-PA 281 GG16651-PA 1..278 1..283 1343 86.6 Plus
Dere\GG14699-PA 460 GG14699-PA 35..301 10..277 397 35.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 02:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19038-PA 283 GH19038-PA 1..283 1..283 1357 85.5 Plus
Dgri\GH19078-PA 287 GH19078-PA 2..278 5..276 803 53 Plus
Dgri\GH15824-PA 446 GH15824-PA 15..287 10..277 382 32.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG8132-PA 283 CG8132-PA 1..283 1..283 1473 100 Plus
NitFhit-PA 460 CG7067-PA 35..301 10..277 383 34.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 02:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24007-PA 283 GI24007-PA 1..283 1..283 1348 84.8 Plus
Dmoj\GI10850-PA 294 GI10850-PA 2..282 5..280 764 51.1 Plus
Dmoj\GI12606-PA 459 GI12606-PA 17..297 10..277 391 33 Plus
Dmoj\GI19662-PA 386 GI19662-PA 138..367 61..277 147 25.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 02:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13819-PA 283 GL13819-PA 1..283 1..283 1431 91.5 Plus
Dper\GL12311-PA 176 GL12311-PA 5..173 84..280 469 42.8 Plus
Dper\GL16112-PA 442 GL16112-PA 16..284 10..277 426 36.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 02:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20841-PA 283 GA20841-PA 1..283 1..283 1431 91.5 Plus
Dpse\GA30242-PA 284 GA30242-PA 2..281 4..280 833 54.4 Plus
Dpse\GA28385-PA 442 GA28385-PA 16..284 10..277 428 36.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 02:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16567-PA 296 GM16567-PA 1..283 1..283 1488 96.1 Plus
Dsec\GM23937-PA 243 GM23937-PA 1..243 1..283 1235 82.7 Plus
Dsec\GM23800-PA 176 GM23800-PA 1..176 1..176 932 97.2 Plus
Dsec\GM23948-PA 171 GM23948-PA 1..171 1..176 857 91.5 Plus
Dsec\GM23959-PA 105 GM23959-PA 1..105 179..283 550 96.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 02:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18612-PA 283 GD18612-PA 1..282 1..282 1500 97.2 Plus
Dsim\GD13552-PA 460 GD13552-PA 35..301 10..277 402 34.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 02:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23638-PA 283 GJ23638-PA 1..283 1..283 1355 84.5 Plus
Dvir\GJ14457-PA 309 GJ14457-PA 23..302 2..276 793 52 Plus
Dvir\GJ12728-PA 456 GJ12728-PA 18..287 14..277 400 32.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 02:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10953-PA 282 GK10953-PA 1..281 1..282 1377 87.9 Plus
Dwil\GK11504-PA 290 GK11504-PA 2..277 5..276 769 52.9 Plus
Dwil\GK17333-PA 473 GK17333-PA 44..313 14..277 388 34.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 02:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25947-PA 283 GE25947-PA 1..283 1..283 1485 95.4 Plus
Dyak\GE21062-PA 438 GE21062-PA 13..279 10..277 401 36 Plus