Clone LD31238 Report

Search the DGRC for LD31238

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:312
Well:38
Vector:pOT2
Associated Gene/TranscriptCG4194-RA
Protein status:LD31238.pep: gold
Preliminary Size:1217
Sequenced Size:1103

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4194 2001-10-10 Blastp of sequenced clone
CG4194 2003-01-01 Sim4 clustering to Release 3
CG4194 2008-04-29 Release 5.5 accounting
CG4194 2008-08-15 Release 5.9 accounting
CG4194 2008-12-18 5.12 accounting

Clone Sequence Records

LD31238.complete Sequence

1103 bp (1103 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061390

> LD31238.complete
ATGCTTCGCTCGCGTTCAGAAGTCTTTGTGTGTTTGCTTATGATCCTGGG
ATCAGTTCTGGTCCGTTCGAATCTTGGGAATCCTCAGGAACTGGAGCTAA
GTGCGCTGCGCACCCACAAACAGCTATTGCAGGCGGAGATCGCACGTCTT
TTTTTAGAGCAGCCGCTTCGAGCGGAAACTCAACTTCTGCTGGAAGATCT
ACAGCTAAGAGATCATCAAATAGGCGTTCAGATAGAAAAGCTCGAGGAAA
TCTCCAAGGGCGAGACCACGCAGAGGCTGGCCATCAATCTAACGGCTGAC
TTTGAACACCTGCAGCATAAATTGGATGATTTGAAACGACAACTTGAGCT
GCTCGACGGACGCTTTGCCTCCCAAGGGAAGCAACTGGAAGGACACTCGT
CGGAAGGCGCATCGCCGGCTGGCCCCGGATTAGGTTCCTTTTTGTGGGGA
CCCTTGCTGACCATGCCAGAGTTTCCACAGGGCAGTGTGGCCAGCGACCA
GCAACATAACCACCACCAGCAGGATCATTCCCCGGATCCGCAGCAGGATT
CCAGTCCCTCTATCATTAAAAGAGTGCTGGACATGCTTAGGCCATCCATA
GGAGTATCAGGTCTGCGGAGTCGTTGGACTGAATCCGCAAAATCAGCTGC
AACGGGCTTGGCAACACCTAAGCCCACTCACCCACTTAGTGCTGAGGAGC
TCCTACCGCAGCTGCAGGAGCAGCGCAGGTTTCTGGACGATGCTATTACG
CGACTGGAGCTCTTGGCCGTCAAGAAGGGCTCGAACAAAAACTAAAATAT
GTGGAAAATCTAAGTAAATCAAACACTTAAATCCATCTATCCAAAAGTTG
AGCTTTGAGATTAAACAGAGGATCAATATTTATTTACTTAAATTGCCAGA
GATCATCATTCATAACCAGATTCGTTGAGTCACTGTCAAAAATTCAGAGA
AATTATACTATACCAAATAAGTAAAGTTCGTTTCATAATGATTTGTGACC
ATTTCCGAAAACAATTGAACTAAAATTAGATTGAACAGTCACCTTAATGA
AAAGTCTAAAGCAATAAATACTAACTATCTTTAAAAAAAAAAAAAAAAAA
AAA

LD31238.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG4194-RA 1099 CG4194-RA 14..1099 1..1086 5430 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 02:33:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 1962521..1963602 1..1082 5380 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:25:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 02:33:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2068607..2069692 1..1086 5430 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2076705..2077790 1..1086 5430 100 Plus
Blast to na_te.dros performed on 2019-03-16 02:33:53 has no hits.

LD31238.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 02:34:38 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 1962521..1963602 1..1082 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:12:33 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:14 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:36:48 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:25 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:15:38 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:12 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 14..1095 1..1082 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:14 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 14..1095 1..1082 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:36:48 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 16..1097 1..1082 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:26 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 1..1082 1..1082 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:15:38 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
CG4194-RA 16..1097 1..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:38 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
X 2068607..2069688 1..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:38 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
X 2068607..2069688 1..1082 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 02:34:38 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
X 2068607..2069688 1..1082 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:36:48 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1962640..1963721 1..1082 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:34 Download gff for LD31238.complete
Subject Subject Range Query Range Percent Splice Strand
X 2076705..2077786 1..1082 100   Plus

LD31238.pep Sequence

Translation from 0 to 794

> LD31238.pep
MLRSRSEVFVCLLMILGSVLVRSNLGNPQELELSALRTHKQLLQAEIARL
FLEQPLRAETQLLLEDLQLRDHQIGVQIEKLEEISKGETTQRLAINLTAD
FEHLQHKLDDLKRQLELLDGRFASQGKQLEGHSSEGASPAGPGLGSFLWG
PLLTMPEFPQGSVASDQQHNHHQQDHSPDPQQDSSPSIIKRVLDMLRPSI
GVSGLRSRWTESAKSAATGLATPKPTHPLSAEELLPQLQEQRRFLDDAIT
RLELLAVKKGSNKN*

LD31238.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:01:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21934-PA 266 GF21934-PA 38..265 46..263 642 62.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12900-PA 258 GG12900-PA 1..258 1..264 1130 88.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:01:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24247-PA 274 GH24247-PA 32..269 17..260 216 42.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG4194-PA 264 CG4194-PA 1..264 1..264 1334 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21442-PA 297 GI21442-PA 45..295 30..261 305 40.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13376-PA 284 GL13376-PA 30..284 29..264 573 56.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18019-PA 284 GA18019-PA 30..284 29..264 573 56.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19191-PA 264 GM19191-PA 1..264 1..264 1155 93.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24730-PA 110 GD24730-PA 1..110 155..264 556 96.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:01:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16461-PA 275 GJ16461-PA 43..270 30..258 280 46.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18840-PA 237 GK18840-PA 9..237 13..260 359 39.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16230-PA 266 GE16230-PA 1..266 1..264 1235 91 Plus

LD31238.hyp Sequence

Translation from 1 to 794

> LD31238.hyp
MLRSRSEVFVCLLMILGSVLVRSNLGNPQELELSALRTHKQLLQAEIARL
FLEQPLRAETQLLLEDLQLRDHQIGVQIEKLEEISKGETTQRLAINLTAD
FEHLQHKLDDLKRQLELLDGRFASQGKQLEGHSSEGASPAGPGLGSFLWG
PLLTMPEFPQGSVASDQQHNHHQQDHSPDPQQDSSPSIIKRVLDMLRPSI
GVSGLRSRWTESAKSAATGLATPKPTHPLSAEELLPQLQEQRRFLDDAIT
RLELLAVKKGSNKN*

LD31238.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG4194-PA 264 CG4194-PA 1..264 1..264 1334 100 Plus