Clone LD31448 Report

Search the DGRC for LD31448

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:314
Well:48
Vector:pOT2
Associated Gene/TranscriptCG8149-RA
Protein status:LD31448.pep: gold
Preliminary Size:1296
Sequenced Size:1149

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8149 2001-01-01 Release 2 assignment
CG8149 2003-01-01 Sim4 clustering to Release 3
CG8149 2003-01-13 Blastp of sequenced clone
CG8149 2008-04-29 Release 5.5 accounting
CG8149 2008-08-15 Release 5.9 accounting
CG8149 2008-12-18 5.12 accounting

Clone Sequence Records

LD31448.complete Sequence

1149 bp (1149 high quality bases) assembled on 2003-01-13

GenBank Submission: AY061392

> LD31448.complete
TTGACAACATTTAAGTAAATTTCGTTCGACAATTGAGAAAATGCCTGAAA
GCGACGTGACTAAAATGAAGGTGGCGGATTTGAAGCGCGAGCTGAAGCTT
CGAGGGCTCGCCGTGAATGGAAATAAAACCGAACTGCAGGACCGATTGCA
GACCGCGTTATTAGAGGGGGACCTTTCTCTGGAGGATTCGGCCATAGCAG
ATGCCATTGACGACGACGATGTGTCTTTCACCGACGAGGATGAGCACAAG
CTGCTGGGCGATGAGAACGACGATGAGCTACTGAAAAGTCCGGTTAGCAC
ACCCACAACTGTGGCCATTCCGGACCTTCTAGCGGAAGAGAAGACGTCTT
CGGCCCCAGATGCAGCTGCGCCGACCAAGAAAATAGTTCTGAAGCGAAAT
AATTCCCAGCAGTCGACGGGCACGGTAGCCAGCACGGGGACAACTCCATC
GAAGGAGAACGAGGCGCCCGCTGCAGCTGCTAGTGACTCCACCGGCGAAA
CTCCTACCAAGAAGCATAAGCCGATTGTGGTCGGACCAAAGACGGAAGGA
GAGAAGCCATCAGGCGACAAGAAACTTAACCAGCTGACTGCACAAGAGCG
ATTGGAACTGCGGGCCAAAAAGTTTGGCATAACACCCCCCGCTGTGGCCA
ACACTGCAACCGCAGTGGCAGTGGCCATCAATAAATCCTCTAGTGCCTCC
ATTACGGCCAACAAAGGTAACAAGGAAACCGAGGAGCAGCAAAAGGAGGC
ACTCAAAAAACGTGCCGAGCGTTTCGGATTCGTGGTGCCTGACAAAGCAC
CGACCTCAAAGGCCGATGATCGTCTCCAGAAACGGAAGGAGCGATTTGGA
GCAGGAGCAGTCTCAGCAGCTACCACCACGCCTACCACAACTGAATCCAA
GGACGCCTGGTCAGAGAAGGCGCGCGCTCGCTTGGAAAGATTCAAAACAG
CCCCGTCCACAAATTAAGAAAAGCGAATATAATTATTTAAGCAAGCAAAT
ACAATTGTAAATCATTTCGGGAGTAGGCCCTATCATGTATCAAACCCCAA
AGCCACCAATGCTTGTAGTAATTAAGCAAAAATTCAATAAACACAAAACA
TGACCACTGAAATTCAGGGTTTACATTAAGAAAAAAAAAAAAAAAAAAA

LD31448.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:28:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG8149-RA 1273 CG8149-RA 142..1269 1..1128 5640 100 Plus
rump-RA 2440 rump-RA 2376..2440 1128..1064 325 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:13:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5330640..5331699 69..1128 5285 99.9 Plus
chr3R 27901430 chr3R 5330518..5330589 1..72 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:25:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9504807..9505866 69..1128 5300 100 Plus
3R 32079331 3R 9504685..9504756 1..72 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9245638..9246697 69..1128 5300 100 Plus
3R 31820162 3R 9245516..9245587 1..72 360 100 Plus
Blast to na_te.dros performed 2019-03-16 04:13:06
Subject Length Description Subject Range Query Range Score Percent Strand
hopper2 1593 hopper2 HOPPER2 1593bp 905..939 44..10 112 80 Minus

LD31448.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:14:03 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5330518..5330587 1..70 100 -> Plus
chr3R 5330642..5331699 71..1130 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:12:45 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 1..927 41..967 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:58:46 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 1..927 41..967 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:21:30 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 1..927 41..967 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:49:30 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 1..927 41..967 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:31:28 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 1..927 41..967 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:15:27 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 26..1153 1..1128 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:58:46 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 25..1151 1..1127 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:21:30 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 30..1156 1..1127 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:49:30 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 26..1153 1..1128 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:31:28 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
CG8149-RA 30..1156 1..1127 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:03 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9504685..9504754 1..70 100 -> Plus
3R 9504809..9505866 71..1130 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:03 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9504685..9504754 1..70 100 -> Plus
3R 9504809..9505866 71..1130 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:03 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9504685..9504754 1..70 100 -> Plus
3R 9504809..9505866 71..1130 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:21:30 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5330407..5330476 1..70 100 -> Plus
arm_3R 5330531..5331588 71..1130 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:21:02 Download gff for LD31448.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9245640..9246697 71..1130 99   Plus
3R 9245516..9245585 1..70 100 -> Plus

LD31448.pep Sequence

Translation from 40 to 966

> LD31448.pep
MPESDVTKMKVADLKRELKLRGLAVNGNKTELQDRLQTALLEGDLSLEDS
AIADAIDDDDVSFTDEDEHKLLGDENDDELLKSPVSTPTTVAIPDLLAEE
KTSSAPDAAAPTKKIVLKRNNSQQSTGTVASTGTTPSKENEAPAAAASDS
TGETPTKKHKPIVVGPKTEGEKPSGDKKLNQLTAQERLELRAKKFGITPP
AVANTATAVAVAINKSSSASITANKGNKETEEQQKEALKKRAERFGFVVP
DKAPTSKADDRLQKRKERFGAGAVSAATTTPTTTESKDAWSEKARARLER
FKTAPSTN*

LD31448.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18934-PA 314 GF18934-PA 1..303 9..302 912 71.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:30:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16820-PA 303 GG16820-PA 1..303 9..308 1170 90.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:30:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18199-PA 337 GH18199-PA 1..324 1..302 806 61.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG8149-PA 308 CG8149-PA 1..308 1..308 1532 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10151-PA 325 GI10151-PA 1..314 1..302 873 66.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:30:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21611-PA 316 GL21611-PA 1..311 1..306 818 67.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:30:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20851-PA 316 GA20851-PA 1..311 1..306 851 68.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23809-PA 300 GM23809-PA 1..300 9..308 1301 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23370-PA 325 GJ23370-PA 1..318 1..306 868 63.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12950-PA 330 GK12950-PA 1..309 1..302 750 59.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:30:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25955-PA 303 GE25955-PA 1..303 9..308 1134 89.1 Plus

LD31448.hyp Sequence

Translation from 40 to 966

> LD31448.hyp
MPESDVTKMKVADLKRELKLRGLAVNGNKTELQDRLQTALLEGDLSLEDS
AIADAIDDDDVSFTDEDEHKLLGDENDDELLKSPVSTPTTVAIPDLLAEE
KTSSAPDAAAPTKKIVLKRNNSQQSTGTVASTGTTPSKENEAPAAAASDS
TGETPTKKHKPIVVGPKTEGEKPSGDKKLNQLTAQERLELRAKKFGITPP
AVANTATAVAVAINKSSSASITANKGNKETEEQQKEALKKRAERFGFVVP
DKAPTSKADDRLQKRKERFGAGAVSAATTTPTTTESKDAWSEKARARLER
FKTAPSTN*

LD31448.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG8149-PA 308 CG8149-PA 1..308 1..308 1532 100 Plus