Clone LD31474 Report

Search the DGRC for LD31474

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:314
Well:74
Vector:pOT2
Associated Gene/TranscriptCG9172-RA
Protein status:LD31474.pep: gold
Preliminary Size:1016
Sequenced Size:879

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9172 2001-10-10 Blastp of sequenced clone
CG9172 2003-01-01 Sim4 clustering to Release 3
CG9172 2008-04-29 Release 5.5 accounting
CG9172 2008-08-15 Release 5.9 accounting
CG9172 2008-12-18 5.12 accounting

Clone Sequence Records

LD31474.complete Sequence

879 bp (879 high quality bases) assembled on 2001-10-10

GenBank Submission: AY061393

> LD31474.complete
AAGTTGAAGTTACATAAATAGCAGGATCAACATGCTGCGTTCGGCGATGA
TGTCATCGACCCTGTCCCGGGCTCTCCAAAAGGCGACTCAGACACCGAAT
GCGTCGATTTCGGCGCTGCCCGCTCTGAATTTGGCCCTGGTGCGCCAACA
ACAAACGCTTCCAGTTGCCGAAGTGGCCCAAAATCTGCCCAAGAAGGGCT
ACTCTCCGTTCGGCACCAAACAGTCCTCCGTTGCGGAGTGGTCACTGGCC
AGACTGGACGATCTGCTCAACTGGGGTCGCAAGGGCTCGATCTGGCCACT
GACTTTCGGTTTGGCCTGCTGTGCCGTCGAAATGATGCACATCGCTGCTC
CGCGTTACGACATGGATCGATATGGTGTTGTGTTCCGTGCATCTCCACGT
CAGGCCGATGTCATCATCGTCGCTGGCACGCTGACCAACAAAATGGCACC
GGCCCTGCGAAAGGTCTACGACCAAATGCCCGAGCCACGTTGGGTCATCT
CCATGGGCAGCTGTGCCAACGGCGGCGGCTACTACCATTACTCGTACTCC
GTCGTCCGTGGCTGCGATAGGATAATCCCCGTCGACATATACGTACCCGG
TTGTCCGCCAACCGCCGAGGCGCTCATGTACGGCGTTTTGCAGCTGCAGA
AGAAGGTTAAGCGGATGAAGACGCTCCAGATGTGGTATAGGAAGTAAGGC
AACGATCGGAACTTATATTTAAAATGTGAAACATCAAACGACATACGATT
TTGCGAACAGAAATCATATTAAATATCGTTCTGTTAACGTTCAGTTGTTG
TATACATTGTTTGTTGGATCACGAGGATATTGCAAATAAATGCCTTTCGA
TATAAATACAAAAAAAAAAAAAAAAAAAA

LD31474.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:15:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG9172-RA 1343 CG9172-RA 46..907 1..862 4310 100 Plus
CG9172.a 1347 CG9172.a 53..911 1..862 4240 99.6 Plus
CG9172-RB 902 CG9172-RB 57..900 19..862 4220 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:03:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15875686..15876526 859..19 4175 99.8 Minus
chr3R 27901430 chr3R 25338694..25339142 248..696 1090 82.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:25:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:03:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15985846..15986689 862..19 4220 100 Minus
3R 32079331 3R 29516034..29516482 248..696 1090 82.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15993944..15994787 862..19 4220 100 Minus
3R 31820162 3R 29256865..29257313 248..696 1090 82.8 Plus
Blast to na_te.dros performed on 2019-03-16 11:03:23 has no hits.

LD31474.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:04:39 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15876575..15876595 1..21 100   Minus
chrX 15875686..15876523 22..859 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:12:46 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:56:16 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:27:13 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RB 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 20:25:27 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:19 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RB 1..666 32..697 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 23:42:14 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 1..859 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:56:16 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 49..907 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:27:13 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 51..909 1..859 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 20:25:27 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 1..859 1..859 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:19 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
CG9172-RA 51..909 1..859 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:39 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
X 15985849..15986686 22..859 100 <- Minus
X 15986738..15986758 1..21 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:39 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
X 15985849..15986686 22..859 100 <- Minus
X 15986738..15986758 1..21 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:04:39 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
X 15985849..15986686 22..859 100 <- Minus
X 15986738..15986758 1..21 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:27:13 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15879882..15880719 22..859 100 <- Minus
arm_X 15880771..15880791 1..21 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:02:36 Download gff for LD31474.complete
Subject Subject Range Query Range Percent Splice Strand
X 15993947..15994784 22..859 100 <- Minus
X 15994836..15994856 1..21 100   Minus

LD31474.pep Sequence

Translation from 31 to 696

> LD31474.pep
MLRSAMMSSTLSRALQKATQTPNASISALPALNLALVRQQQTLPVAEVAQ
NLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVE
MMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYDQMP
EPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMY
GVLQLQKKVKRMKTLQMWYRK*

LD31474.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 10:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19983-PA 217 GF19983-PA 1..217 1..221 981 82.8 Plus
Dana\GF23350-PA 211 GF23350-PA 26..211 37..221 874 84.9 Plus
Dana\GF23344-PA 212 GF23344-PA 28..212 37..221 865 83.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 10:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19352-PA 221 GG19352-PA 1..221 1..221 1165 98.2 Plus
Dere\GG11669-PA 212 GG11669-PA 26..212 36..221 876 86.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 10:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21035-PA 226 GH21035-PA 1..226 1..221 985 82.4 Plus
Dgri\GH11286-PA 209 GH11286-PA 18..209 30..221 868 80.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:41
Subject Length Description Subject Range Query Range Score Percent Strand
ND-20-PC 221 CG9172-PC 1..221 1..221 1158 100 Plus
ND-20-PA 221 CG9172-PA 1..221 1..221 1158 100 Plus
ND-20-PB 221 CG9172-PB 1..221 1..221 1158 100 Plus
ND-20L-PB 212 CG2014-PB 27..212 37..221 873 85.5 Plus
ND-20L-PA 212 CG2014-PA 27..212 37..221 873 85.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 10:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18637-PA 223 GI18637-PA 1..223 1..221 983 83 Plus
Dmoj\GI24498-PA 205 GI24498-PA 16..205 32..221 869 81.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 10:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16625-PA 220 GL16625-PA 1..220 1..221 1025 86.9 Plus
Dper\GL13892-PA 205 GL13892-PA 13..205 30..221 885 82.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 10:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21592-PA 220 GA21592-PA 1..220 1..221 1025 86.9 Plus
Dpse\GA15185-PA 211 GA15185-PA 19..211 30..221 885 82.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 10:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11675-PA 221 GM11675-PA 1..221 1..221 1158 97.7 Plus
Dsec\GM12792-PA 204 GM12792-PA 14..204 32..221 869 83.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 10:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15767-PA 221 GD15767-PA 1..221 1..221 1168 98.6 Plus
Dsim\GD21440-PA 212 GD21440-PA 27..212 37..221 867 85.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 10:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21650-PA 223 GJ21650-PA 1..223 1..221 974 81.2 Plus
Dvir\GJ16291-PA 209 GJ16291-PA 18..209 30..221 889 82.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 10:02:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17823-PA 229 GK17823-PA 1..229 1..221 991 82.8 Plus
Dwil\GK19502-PA 213 GK19502-PA 1..213 6..221 886 75.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 10:02:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15999-PA 221 GE15999-PA 1..221 1..221 1155 97.3 Plus
Dyak\GE23857-PA 212 GE23857-PA 22..212 32..221 868 83.8 Plus

LD31474.hyp Sequence

Translation from 31 to 696

> LD31474.hyp
MLRSAMMSSTLSRALQKATQTPNASISALPALNLALVRQQQTLPVAEVAQ
NLPKKGYSPFGTKQSSVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVE
MMHIAAPRYDMDRYGVVFRASPRQADVIIVAGTLTNKMAPALRKVYDQMP
EPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMY
GVLQLQKKVKRMKTLQMWYRK*

LD31474.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:47:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG9172-PC 221 CG9172-PC 1..221 1..221 1158 100 Plus
CG9172-PA 221 CG9172-PA 1..221 1..221 1158 100 Plus
CG9172-PB 221 CG9172-PB 1..221 1..221 1158 100 Plus
CG2014-PB 212 CG2014-PB 27..212 37..221 873 85.5 Plus
CG2014-PA 212 CG2014-PA 27..212 37..221 873 85.5 Plus