Clone LD31988 Report

Search the DGRC for LD31988

Clone and Library Details

Library:LD
Tissue Source:Drosophila melanogaster embryo
Created by:Ling Hong
Date Registered:1997-12-04
Comments:Constructed using Stratagene ZAP-cDNA Synthesis kit. Oligo dT-primed and directionally cloned at EcoRI and XhoI in BlueScript SK(+/-)
Original Plate Number:319
Well:88
Vector:pOT2
Associated Gene/TranscriptCG12909-RA
Protein status:LD31988.pep: gold
Preliminary Size:1233
Sequenced Size:1052

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12909 2001-01-01 Release 2 assignment
CG12909 2001-12-12 Blastp of sequenced clone
CG12909 2003-01-01 Sim4 clustering to Release 3
CG12909 2008-04-29 Release 5.5 accounting
CG12909 2008-08-15 Release 5.9 accounting
CG12909 2008-12-18 5.12 accounting

Clone Sequence Records

LD31988.complete Sequence

1052 bp (1052 high quality bases) assembled on 2001-12-12

GenBank Submission: AY070557

> LD31988.complete
TTTTGTTTGGCCTCCGCCGGCGGTAAATTCAACCAAATTACCTGAAATTC
CAAGGATTCCCCGGTAAACAAGAGATCAGCGACTGCTACACCATGGTCTT
CTTCACGTGCAACATCTGCGGCGAGTCGGTAAAGAAACCGGCGGTGGAAA
AGCACTACCAGACGCGCTGTCGCGGCAAAGACAAGAACGTGTCCTGCATG
GACTGCCTAAAGGACTTCTATGGCGAGGAGTATGTGGCACACATTAAGTG
CATCTCAGAGGCCCAGAAGTACGCCAGCCAAAGCCAAGGCTTTGCCGCCA
AGGAGCCCCGCAACAAGAACGCTCAAAAGCAAGAGAGTTGGATGGACATC
ATTCGGTCGATCCTCGACAGCAGCGAGTACAATTTAACTCCAGCCGTTCG
ATCCGCCTTCCAAAAGCTCCAGAGCGTCGACAACGTGCCCCGCAAGAAGG
CTAAGTTCGAAAACTTCGTGGGAAACTGCATGCGCATGCCCCGCAACCAG
GCCACCCAGGTGTGGGATATTCTCGAGAAGGAGCTGAACAAGATGAAGGA
GGCAAAGCAAGCGGAGCTGGCCAGAGCCAAGGCGGAAAAGATTGCTGAAA
TACAGCAGAAGCAGAAGGCAGAGGTCGAGGAAGAGGCGCCACCCAAGAAG
AAGGCCAAAGTGGAGACCACAGAAGATGCTGCTGCCGAGGAGACCTCCAA
CGGCGTGACCAGCGACTTTGATTGGGCCGCCCAGCTAACTAAGATCGTTA
CCAAGCAAGCAGATGGCATTTTCCTGGAAAAACTTCGTAAGAAGCTGCTC
AAGAAGTATGCCAAGCATCTGTCCGTCGAGGATTTGAACGAAAAACAGGC
GAAGAAGTTTCAGAAACGCTTTGATAAGCAACTTAAGCTCGCCGATTCCT
TGGAAGTCGAGGGTGAAATAGTTAAGATCGCTAGCTAGCCGAATATCCCA
CCTTTAGTCATAGTTTAATTATAACAAAAGGACAATAAACGTGTAAGCTG
GAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AA

LD31988.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG12909-RA 1020 CG12909-RA 20..1020 1..1001 5005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6197660..6198660 1..1001 5005 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 19:25:47 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10310143..10311145 1..1003 5015 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10311342..10312344 1..1003 5015 100 Plus
Blast to na_te.dros performed on 2019-03-16 04:14:31 has no hits.

LD31988.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:15:33 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6197660..6198660 1..1001 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 19:13:18 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 1..846 93..938 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:18:59 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 1..846 93..938 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:22:25 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 1..846 93..938 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:45:06 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 1..846 93..938 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:32:28 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 1..846 93..938 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:52:11 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 20..1020 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:18:59 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 20..1020 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:22:25 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 31..1031 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:45:07 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 20..1020 1..1001 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:32:28 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
CG12909-RA 31..1031 1..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:33 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10310143..10311143 1..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:33 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10310143..10311143 1..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:15:33 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10310143..10311143 1..1001 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:22:25 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6197648..6198648 1..1001 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:21:27 Download gff for LD31988.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10311342..10312342 1..1001 100   Plus

LD31988.pep Sequence

Translation from 92 to 937

> LD31988.pep
MVFFTCNICGESVKKPAVEKHYQTRCRGKDKNVSCMDCLKDFYGEEYVAH
IKCISEAQKYASQSQGFAAKEPRNKNAQKQESWMDIIRSILDSSEYNLTP
AVRSAFQKLQSVDNVPRKKAKFENFVGNCMRMPRNQATQVWDILEKELNK
MKEAKQAELARAKAEKIAEIQQKQKAEVEEEAPPKKKAKVETTEDAAAEE
TSNGVTSDFDWAAQLTKIVTKQADGIFLEKLRKKLLKKYAKHLSVEDLNE
KQAKKFQKRFDKQLKLADSLEVEGEIVKIAS*

LD31988.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 09:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12791-PA 275 GF12791-PA 1..275 1..281 1203 80.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 09:13:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24160-PA 282 GG24160-PA 1..282 1..281 1258 90.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 09:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21782-PA 273 GH21782-PA 1..273 1..281 994 74.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12909-PA 281 CG12909-PA 1..281 1..281 1438 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 09:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19328-PA 280 GI19328-PA 1..273 1..278 1020 77 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 09:14:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10459-PA 287 GL10459-PA 1..285 1..278 1055 73.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 09:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11899-PA 289 GA11899-PA 1..287 1..278 1047 73.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 09:14:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21209-PA 281 GM21209-PA 1..281 1..281 1267 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 09:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10732-PA 259 GD10732-PA 1..259 1..281 1118 82.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 09:14:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22206-PA 282 GJ22206-PA 1..280 1..278 940 72.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 09:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17792-PA 275 GK17792-PA 1..273 1..278 879 71 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 09:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19354-PA 282 GE19354-PA 1..282 1..281 1200 89.7 Plus

LD31988.hyp Sequence

Translation from 92 to 937

> LD31988.hyp
MVFFTCNICGESVKKPAVEKHYQTRCRGKDKNVSCMDCLKDFYGEEYVAH
IKCISEAQKYASQSQGFAAKEPRNKNAQKQESWMDIIRSILDSSEYNLTP
AVRSAFQKLQSVDNVPRKKAKFENFVGNCMRMPRNQATQVWDILEKELNK
MKEAKQAELARAKAEKIAEIQQKQKAEVEEEAPPKKKAKVETTEDAAAEE
TSNGVTSDFDWAAQLTKIVTKQADGIFLEKLRKKLLKKYAKHLSVEDLNE
KQAKKFQKRFDKQLKLADSLEVEGEIVKIAS*

LD31988.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG12909-PA 281 CG12909-PA 1..281 1..281 1438 100 Plus